Entry information : SmPrx29-1_10 (SmPrx29a_10)
Entry ID 7037
Creation 2009-10-14 (Paula Nunes)
Last sequence changes 2009-10-14 (Paula Nunes)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: SmPrx29-1_10 (SmPrx29a_10)
Name (synonym) SmPrx29-1_10 (SmPrx29a_10)
Class Class III peroxidase    [Orthogroup: Prx345]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx29-1_10
start..stop
S start..stop
SmPrx29-2_29 666 0 1..327 1..327
SpolPrx41 290 1.11e-97 25..327 22..325
SmPrx82-1_124 286 3.84e-96 29..327 24..323
SpolPrx05 285 1.16e-95 4..327 7..325
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7037' 'join(1621854..1622075,1622128..1622316,1622368..1622533,1622589..1622995)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1621854..1622075 220 N° 2 1622128..1622316 187 N° 3 1622368..1622533 164 N° 4 1622589..1622995 405
join(1621854..1622075,1622128..1622316,1622368..1622533,1622589..1622995)


exon

Literature and cross-references SmPrx29-1_10 (SmPrx29a_10)
DNA ref. Phytozome 12:   scaffold_10 (1621854..1622995)
mRNA ref. JGI transcript:   409361 [Incorrect splicing]
Protein sequence: SmPrx29-1_10 (SmPrx29a_10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (306)
PWM (Da):   %s   35783.85 (33224.5)  
PI (pH):   %s   6.04 (5.18) Peptide Signal:   %s   cut: 22 range:22-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKYGCLVLVFFLAFSFRRFFSEDTLPAGMAYNYYSKSCPLAEQVI
YQTMVIAKQLHAGITSDVTRLAFHDAFVE
GCDASALIKSTPGNLAEMNASVNKFLEGFELIDAAKFQLEILCPNTVSCADIIQFAARDGVRLDGGPFYALPGGRLDGRVSKASRATQFLPLPTMNVSELKANFAAKNFTLEELATLSGA
HTIGEAHCSSFKDRLYNFTGNGDQDPSLDPTYARELKAKCPQSATSDDTVPMESEPSTSKVNTVYYRDILRSKSIFTSDQTLVNDPITRATVVQFANSTEIFFQKFAAAMLKMSLLEVNK
PGGEIRYHCGSIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from JGI (first 30 aa are missing). No EST . Missing 'c'. containing motif fhda.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTATGGCTGTTTGGTTTTAGTGTTCTTCCTGGCGTTTAGTTTTAGACGTTTCTTTTCGGAAGACACTCTTCCGGCGGGTATGGCGTACAACTATTACTCCAAGAGCTGTCCGCTA
GCCGAGCAAGTTATCTATCAAACCATGGTTATTGCTAAGCAGCTGCATGCCGGTATCACCTCGGACGTTACTCGATTGGCTTTCCACGACGCTTTTGTAGAG
AGGTAATTCATTCAAGTC
GGGTTTGACAGTGATTGTGAATTCTTTTATTGACAGGGATGCGATGCTTCGGCTTTGATAAAGTCCACGCCGGGAAATCTAGCCGAGATGAATGCCTCCGTGAATAAGTTTCTGGAGGGC
TTTGAGTTGATAGACGCTGCAAAGTTTCAGCTCGAGATCTTGTGCCCAAACACAGTCTCGTGTGCTGATATCATCCAGTTTGCAGCTCGCGATGGAGTCCGGCTG
TGGTAAGAATAAATT
TAAATCACTCCAAAGTTTACTTTTCTTGTTTGTGCTAGGATGGAGGGCCTTTTTATGCTCTCCCAGGCGGACGACTAGACGGTCGAGTCTCTAAAGCTTCGAGAGCTACACAATTTTTGC
CCTTGCCAACAATGAACGTCAGCGAGCTTAAGGCCAACTTTGCAGCCAAGAACTTCACTCTCGAAGAGCTCGCAACTCTCTCAG
AGGTAAAGCTTGTCACGAAAACTCTGACTAACTCTT
GAGAAAAAACTTCTTTTGTAGGAGCTCACACCATTGGAGAAGCGCATTGCTCCTCGTTCAAGGATCGCTTGTACAACTTCACGGGAAATGGTGACCAGGATCCATCACTGGATCCAACAT
ATGCGAGAGAGCTCAAGGCAAAATGCCCCCAGTCAGCCACAAGCGATGACACGGTTCCCATGGAGTCGGAGCCTTCCACTTCCAAGGTGAACACAGTCTACTACAGGGACATCCTTCGAA
GCAAAAGTATATTTACATCGGACCAGACGCTGGTGAATGATCCCATCACGAGAGCTACTGTTGTCCAGTTCGCTAACAGCACAGAGATCTTCTTCCAGAAGTTTGCAGCCGCGATGCTCA
AGATGAGCCTGCTGGAAGTGAACAAACCTGGAGGAGAGATCCGATATCACTGTGGCTCCATTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGTATGGCTGTTTGGTTTTAGTGTTCTTCCTGGCGTTTAGTTTTAGACGTTTCTTTTCGGAAGACACTCTTCCGGCGGGTATGGCGTACAACTATTACTCCAAGAGCTGTCCGCTA
GCCGAGCAAGTTATCTATCAAACCATGGTTATTGCTAAGCAGCTGCATGCCGGTATCACCTCGGACGTTACTCGATTGGCTTTCCACGACGCTTTTGTAGAG
GGATGCGATGCTTCGGCT
TTGATAAAGTCCACGCCGGGAAATCTAGCCGAGATGAATGCCTCCGTGAATAAGTTTCTGGAGGGCTTTGAGTTGATAGACGCTGCAAAGTTTCAGCTCGAGATCTTGTGCCCAAACACA
GTCTCGTGTGCTGATATCATCCAGTTTGCAGCTCGCGATGGAGTCCGGCTG
GATGGAGGGCCTTTTTATGCTCTCCCAGGCGGACGACTAGACGGTCGAGTCTCTAAAGCTTCGAGAGCT
ACACAATTTTTGCCCTTGCCAACAATGAACGTCAGCGAGCTTAAGGCCAACTTTGCAGCCAAGAACTTCACTCTCGAAGAGCTCGCAACTCTCTCAG
GAGCTCACACCATTGGAGAAGCG
CATTGCTCCTCGTTCAAGGATCGCTTGTACAACTTCACGGGAAATGGTGACCAGGATCCATCACTGGATCCAACATATGCGAGAGAGCTCAAGGCAAAATGCCCCCAGTCAGCCACAAGC
GATGACACGGTTCCCATGGAGTCGGAGCCTTCCACTTCCAAGGTGAACACAGTCTACTACAGGGACATCCTTCGAAGCAAAAGTATATTTACATCGGACCAGACGCTGGTGAATGATCCC
ATCACGAGAGCTACTGTTGTCCAGTTCGCTAACAGCACAGAGATCTTCTTCCAGAAGTTTGCAGCCGCGATGCTCAAGATGAGCCTGCTGGAAGTGAACAAACCTGGAGGAGAGATCCGA
TATCACTGTGGCTCCATTAACTAG

Retrieve as FASTA