Entry information : SmPrx29-2_29 (SmPrx29b_29)
Entry ID 7038
Creation 2009-10-14 (Paula Nunes)
Last sequence changes 2009-10-14 (Paula Nunes)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: SmPrx29-2_29 (SmPrx29b_29)
Name (synonym) SmPrx29-2_29 (SmPrx29b_29)
Class Class III peroxidase    [Orthogroup: Prx281]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx29-2_29
start..stop
S start..stop
SmPrx29-1_10 666 0 1..327 1..327
SpolPrx41 291 6e-98 25..327 22..325
SmPrx82-1_124 288 4e-97 29..327 24..323
SpolPrx05 285 2e-95 4..327 7..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1772979..1773200 222 N° 2 1772738..1772926 189 N° 3 1772520..1772685 166 N° 4 1772058..1772464 407
complement(join(1772058..1772464,1772520..1772685,1772738..1772926,1772979..1773 200))


exon

Literature and cross-references SmPrx29-2_29 (SmPrx29b_29)
DNA ref. Phytozome 12:   scaffold_29 (1773200..1772058)
mRNA ref. JGI transcript:   151081 [Incorrect prediction]
EST ref. GenBank:   FE445645.1 [3' end]   FE445646.1 [3' end]
Protein sequence: SmPrx29-2_29 (SmPrx29b_29)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (306)
PWM (Da):   %s   35703.77 (33244.5) Transmb domain:   %s   i2-21o
PI (pH):   %s   5.19 (5.02) Peptide Signal:   %s   cut: 22 range:22-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTYGCLVLVFFLAFGFRLFFSEDTLPAGMAYNYYSKSCPLAEQVIYQTMVIAKQLHAGITSDVTRLAFHDAFVEGCDASALIKSTPGNLAEMNASVNKFLEGFELIDAAKFQLEILCPNTVSCADIIQFAARDGVRLDGGPFYALPGGRLDGRVSKASRATQFLPLPTMNVSELKANFAAKNFTLEELATLSGAHTIGESHCSSFKDRLYNFTGNGDQDPSLDPTYARELKAKCPQSATSDDTVPMESEPSTSKVNTVYYRDILRSKSIFTSDQTLVNDPITRATVVQFANNTEIFFQKFAAAMLKMSLLEVNKPGGEIRYNCGSIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 3 ESTs. Incorrect transcript prediction from JGI (Large PS is missing). Missing 'c'. containing motif fhda.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGTATGGCTGTTTGGTTTTAGTGTTCTTCCTGGCGTTTGGTTTTAGACTTTTCTTTTCGGAAGACACTCTTCCGGCGGGTATGGCGTACAACTATTACTCCAAGAGCTGTCCGCTA
GCCGAGCAAGTTATCTATCAAACCATGGTTATTGCTAAGCAGCTGCATGCCGGTATCACCTCGGACGTTACTCGATTGGCTTTCCACGACGCTTTTGTAGAG
GTAATTCATTCAAGTCGG
GTTTGATAGTGATTGTGAACTCTTTCATTGACAGGGATGCGATGCTTCAGCTTTGATAAAGTCCACGCCGGGAAATCTAGCCGAGATGAATGCGTCCGTGAATAAGTTTCTGGAGGGCTT
TGAGTTGATAGACGCTGCAAAGTTTCAGCTCGAGATCTTGTGCCCAAACACAGTCTCGTGTGCTGATATCATCCAGTTTGCAGCTCGCGATGGAGTCCGGCTG
GTAAGAAAATTTTTTAA
ATCACTCCAAAGTTTACTTTTCTTCTTTGTGCTAGGATGGAGGGCCTTTTTATGCTCTCCCAGGCGGACGACTAGACGGTCGAGTCTCTAAAGCTTCGAGAGCTACACAATTTTTGCCCT
TGCCAACAATGAACGTCAGCGAGCTTAAGGCCAACTTTGCAGCCAAGAACTTCACTCTCGAAGAGCTCGCAACTCTCTCAG
GTAAAACTTGTCACGAAAACTCCGATTAACTCTTGAGAA
AAACCTTCTTTTGTAGGAGCTCACACCATTGGAGAATCGCATTGCTCCTCGTTCAAGGATCGCTTGTACAACTTCACGGGAAATGGTGACCAGGATCCATCACTGGATCCAACATATGCG
AGAGAGCTCAAGGCAAAATGCCCCCAGTCAGCCACAAGCGATGACACGGTTCCCATGGAGTCGGAGCCTTCCACTTCCAAGGTGAACACAGTCTACTACAGGGACATCCTTCGAAGCAAA
AGTATATTTACATCGGACCAGACGCTGGTGAATGATCCCATCACGAGAGCTACTGTTGTCCAGTTCGCTAACAACACAGAGATCTTCTTCCAGAAGTTTGCAGCCGCGATGCTCAAGATG
AGCCTGCTGGAAGTGAACAAACCTGGAGGAGAGATCCGATATAACTGTGGCTCCATTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGTATGGCTGTTTGGTTTTAGTGTTCTTCCTGGCGTTTGGTTTTAGACTTTTCTTTTCGGAAGACACTCTTCCGGCGGGTATGGCGTACAACTATTACTCCAAGAGCTGTCCGCTA
GCCGAGCAAGTTATCTATCAAACCATGGTTATTGCTAAGCAGCTGCATGCCGGTATCACCTCGGACGTTACTCGATTGGCTTTCCACGACGCTTTTGTAGAG
GGATGCGATGCTTCAGCT
TTGATAAAGTCCACGCCGGGAAATCTAGCCGAGATGAATGCGTCCGTGAATAAGTTTCTGGAGGGCTTTGAGTTGATAGACGCTGCAAAGTTTCAGCTCGAGATCTTGTGCCCAAACACA
GTCTCGTGTGCTGATATCATCCAGTTTGCAGCTCGCGATGGAGTCCGGCTG
GATGGAGGGCCTTTTTATGCTCTCCCAGGCGGACGACTAGACGGTCGAGTCTCTAAAGCTTCGAGAGCT
ACACAATTTTTGCCCTTGCCAACAATGAACGTCAGCGAGCTTAAGGCCAACTTTGCAGCCAAGAACTTCACTCTCGAAGAGCTCGCAACTCTCTCAG
GAGCTCACACCATTGGAGAATCG
CATTGCTCCTCGTTCAAGGATCGCTTGTACAACTTCACGGGAAATGGTGACCAGGATCCATCACTGGATCCAACATATGCGAGAGAGCTCAAGGCAAAATGCCCCCAGTCAGCCACAAGC
GATGACACGGTTCCCATGGAGTCGGAGCCTTCCACTTCCAAGGTGAACACAGTCTACTACAGGGACATCCTTCGAAGCAAAAGTATATTTACATCGGACCAGACGCTGGTGAATGATCCC
ATCACGAGAGCTACTGTTGTCCAGTTCGCTAACAACACAGAGATCTTCTTCCAGAAGTTTGCAGCCGCGATGCTCAAGATGAGCCTGCTGGAAGTGAACAAACCTGGAGGAGAGATCCGA
TATAACTGTGGCTCCATTAACTAG

Retrieve as FASTA