Entry information : SmPrx28-2_6 (SmPrx28b_6)
Entry ID 7039
Creation 2009-10-14 (Paula Nunes)
Last sequence changes 2009-10-14 (Paula Nunes)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: SmPrx28-2_6 (SmPrx28b_6)
Name (synonym) SmPrx28-2_6 (SmPrx28b_6)
Class Class III peroxidase    [Orthogroup: Prx280]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx28-2_6
start..stop
S start..stop
SmPrx28-1_10 674 0 1..332 1..332
PtaPrx09 317 5e-108 46..331 42..324
PabPrx152 313 1e-106 29..331 30..326
PabPrx108 313 1e-106 29..331 30..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2288529..2288592 64 N° 2 2288302..2288468 167 N° 3 2288053..2288238 186 N° 4 2287837..2287999 163
N° 5 2287368..2287786 419  
complement(join(2287368..2287786,2287837..2287999,2288053..2288238,2288302..2288 468,2288529..2288592))


exon

Literature and cross-references SmPrx28-2_6 (SmPrx28b_6)
DNA ref. Phytozome 12:   scaffold_6 (2288592..2287368)
mRNA ref. JGI transcript:   407109
Protein sequence: SmPrx28-2_6 (SmPrx28b_6)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (310)
PWM (Da):   %s   35175.95 (33074.9) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.4 (8.59) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAANSVVLVVISCCLIAASNAQNIFSPLMLGYYNRPGICNQNPEVIIQKIVNGSVAADRTLAAGLLRMHFHDAFVGTEASVLLKSPNNDAERNAIPNLSLRGFEVIDAAKAAVEKVCPNVVSCADILALAARDSVVAIGGPWWPVPTGRRDGVQSHANETTDLPPPSANFTQLLSMFQKKNLDKVDLVALSAAHTIGRGHCGAFSSRIYDAAGNNAIDPTLDAAYANKLRGFCPPRDTVTTVEMDPNSSLNFDSHYFQAVLAKQGLFKSDAALLTDAGARSLVQTGASAPIIFKSQFGFSMTKMGRIGVLTGRPGEPPSQIRKQCAFVNP

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns: extra 5'). No EST. Missing 'c'. containing motif fhda.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCGAATTCCGTCGTTCTGGTGGTAATATCATGCTGCCTGATTGCTGCGAGCAATGGTATGAATTTTCCTTCGTTCTTCCCAAGAGATAAATTTGGTGGCTTTCCGTCGTTC
CCAGCGCAAAACATATTTTCTCCGTTGATGTTGGGTTACTACAATCGTCCCGGAATCTGCAATCAAAATCCAGAAGTTATTATCCAAAAAATTGTAAATGGTTCTGTTGCTGCCGACCGT
ACTTTAGCAGCGGGCCTCCTCCGGATGCATTTTCATGACGCTTTCGTCAGG
GTGTGTAGTCATCTTTCCAAGTAGTTTTGTATGGATAACTGAAAAATGTTGTCCTGTTGCCAGGGTACT
GAAGCTTCGGTGCTGCTCAAGTCTCCAAACAATGACGCCGAGAGAAATGCCATTCCAAATCTCAGCTTGAGAGGTTTCGAGGTGATCGACGCAGCAAAAGCCGCGGTGGAGAAAGTTTGT
CCCAATGTAGTCTCTTGTGCTGATATTCTTGCTCTGGCGGCACGCGACAGTGTTGTAGCT
GTAAGCAAAATGACCAGGATCAGTCGCTCAAAGTTCTAACGGTTTCGATTCAGATTGGTG
GACCTTGGTGGCCAGTTCCAACTGGTCGCCGCGACGGAGTCCAAAGTCATGCCAACGAGACGACGGATTTGCCACCACCTTCTGCAAACTTCACTCAGCTTCTCAGCATGTTCCAGAAAA
AGAACCTCGACAAGGTTGATCTTGTTGCCCTGTCAG
GTACGTATCACATAACTCAGTAGCAGTCTTCGCTGATAATATTGCCACAGCTGCACATACCATTGGAAGAGGTCACTGTGGTGC
TTTCTCGAGCCGCATTTACGATGCCGCTGGTAACAATGCTATCGATCCCACACTGGACGCAGCTTATGCCAACAAGCTGAGAGGCTTCTGCCCGCCAAGAGATACAGTAACCACCGTAGA
AATGGATCCCAATAGCAGCCTCAACTTCGACAGTCACTACTTCCAGGCGGTACTCGCCAAACAGGGCCTCTTCAAATCGGACGCGGCGTTGCTGACTGACGCTGGTGCTCGAAGCCTTGT
TCAAACGGGTGCTAGCGCTCCTATCATTTTCAAGTCCCAGTTTGGATTCTCTATGACCAAGATGGGCAGGATTGGCGTACTCACGGGACGTCCAGGAGAACCTCCGAGCCAAATTAGAAA
ACAGTGCGCTTTTGTGAACCCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCGAATTCCGTCGTTCTGGTGGTAATATCATGCTGCCTGATTGCTGCGAGCAATGCGCAAAACATATTTTCTCCGTTGATGTTGGGTTACTACAATCGTCCCGGAATCTGC
AATCAAAATCCAGAAGTTATTATCCAAAAAATTGTAAATGGTTCTGTTGCTGCCGACCGTACTTTAGCAGCGGGCCTCCTCCGGATGCATTTTCATGACGCTTTCGTCAGG
GGTACTGAA
GCTTCGGTGCTGCTCAAGTCTCCAAACAATGACGCCGAGAGAAATGCCATTCCAAATCTCAGCTTGAGAGGTTTCGAGGTGATCGACGCAGCAAAAGCCGCGGTGGAGAAAGTTTGTCCC
AATGTAGTCTCTTGTGCTGATATTCTTGCTCTGGCGGCACGCGACAGTGTTGTAGCT
ATTGGTGGACCTTGGTGGCCAGTTCCAACTGGTCGCCGCGACGGAGTCCAAAGTCATGCCAAC
GAGACGACGGATTTGCCACCACCTTCTGCAAACTTCACTCAGCTTCTCAGCATGTTCCAGAAAAAGAACCTCGACAAGGTTGATCTTGTTGCCCTGTCAG
CTGCACATACCATTGGAAGA
GGTCACTGTGGTGCTTTCTCGAGCCGCATTTACGATGCCGCTGGTAACAATGCTATCGATCCCACACTGGACGCAGCTTATGCCAACAAGCTGAGAGGCTTCTGCCCGCCAAGAGATACA
GTAACCACCGTAGAAATGGATCCCAATAGCAGCCTCAACTTCGACAGTCACTACTTCCAGGCGGTACTCGCCAAACAGGGCCTCTTCAAATCGGACGCGGCGTTGCTGACTGACGCTGGT
GCTCGAAGCCTTGTTCAAACGGGTGCTAGCGCTCCTATCATTTTCAAGTCCCAGTTTGGATTCTCTATGACCAAGATGGGCAGGATTGGCGTACTCACGGGACGTCCAGGAGAACCTCCG
AGCCAAATTAGAAAACAGTGCGCTTTTGTGAACCCGTAA

Retrieve as FASTA