1. Browse the Database
  2. View Redoxidase
Entry information : SmPrx52-1_16 (SmPrx52a_16)
Entry ID 7041
Creation 2009-12-18 (Christophe Dunand)
Last sequence changes 2009-12-18 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: SmPrx52-1_16 (SmPrx52a_16)
Name (synonym) SmPrx52-1_16 (SmPrx52a_16)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx52-1_16
start..stop		 S start..stop
SmPrx52-2_1 697 0 1..346 1..346
SmPrx[P]54a_16 509 0 96..346 1..251
SmPrx[P]53b_1 509 0 96..346 1..251
SmPrx[P]53a_16 509 0 96..346 1..251
Gene structure Fichier Exons►


exon

Literature and cross-references SmPrx52-1_16 (SmPrx52a_16)
DNA ref. Phytozome 12:   scaffold_16 (1504294..1502418)
mRNA ref. JGI transcript:   95196 [Incorrect prediction]
Protein sequence: SmPrx52-1_16 (SmPrx52a_16)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346
PWM (Da):   %s   36814.89  
PI (pH):   %s   8.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSLAAFFAALSGKYLARSLGGGARMKTYRGMLLLSVMLVATISGGNSGLRVGFYSSSCPNAESIVRAAFSGNFITDPTAPAALLRLAFHDCQVGCDASILLDSKGSIKSERDSDKNFGI
RRLDFIDRIKSMLEAACPGVVSCADIIVLVARESIVFTGGPTIPVLTGRRDGTAASNAAADRLLPPATVSVDNFISLFASKGLSLDESVAIIGAHTIGVGHCVNIVNRLYPNQDSKIGLL
FASRLRVQCPTANPRMLNNITVINNDMTNLVFDNQYFRDLMNGQGLFTIDSELALDSRTSPVVARFSTNQQLFLDTFSSAFVKLTSSNVLTGQSGQVRKYCHSVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3 and extra 5' intron). No EST. Incorrect predict from JGI. Containing IntR (5').
DNA ►
Send to BLAST
CDS►
Send to BLAST