Entry information : SmPrx11-1_35 (SmPrx11a_35)
Entry ID 7042
Creation 2009-10-15 (Paula Nunes)
Last sequence changes 2009-10-15 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx11-1_35 (SmPrx11a_35)
Name (synonym) SmPrx11-1_35 (SmPrx11a_35)
Class Class III peroxidase    [Orthogroup: Prx247]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx11-1_35
start..stop
S start..stop
SmPrx11-2_41 672 0 1..332 1..332
SmPrx12-1_113 425 9.58e-151 14..332 9..326
SmPrx12-2_55 422 1.8e-149 14..332 9..326
SmPrx52-2_1 373 6.9e-130 17..332 33..346
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7042' 'join(158798..159034,159145..159502,159762..160165)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 158798..159034 235 N° 2 159145..159502 356 N° 3 159762..160165 402  
join(158798..159034,159145..159502,159762..160165)


exon

Literature and cross-references SmPrx11-1_35 (SmPrx11a_35)
DNA ref. Phytozome 12:   scaffold_35 (158798..160165)
mRNA ref. JGI transcript:   107369 [Incorrect prediction]
EST ref. GenBank:   FE505430.1 [5' end]  FE505429.1 [3' end]
Protein sequence: SmPrx11-1_35 (SmPrx11a_35)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (299)
PWM (Da):   %s   35625.4 (31740.5)  
PI (pH):   %s   6.11 (5.72) Peptide Signal:   %s   cut: 34 range:34-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDHSLTALSSRWRWSTFLFSAMILAEFFPLSQQLSYDYYDNVCPQ
AERTVRASISSNLAGDPTAAAALLRLAFHDCQVG
GCDASIMLNSQGGITSEMVASKNFGIRRLNLIDNAKAAVDSQCGPGRVSCADIIAMAGRDAVVFAGGPDFRIPMGRLDSTFASNAAADSSLPPTTISVDNFLNLFGSMGMSTEESVAIMG
GGHTLGVGHCVNIVNRLYPNAESTLSFVYATRLRVSCPSSDPRFIINATTVQNDFSSLQFDNQYFREATMGLGLFTIDAALASDARTSPIVARFSQNQNSFFNAFASAYAKLTSFNVLTG
NRGEVRNNCRFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3) and 2 ESTs. Incorrect prediction (Short SP).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCACAGCCTAACTGCATTGTCGTCTCGATGGAGGTGGAGCACTTTCCTGTTCTCGGCGATGATCCTGGCGGAGTTCTTCCCCCTGTCCCAGCAACTTTCGTACGATTACTACGAC
AACGTCTGTCCCCAGGCCGAAAGAACTGTGAGAGCTTCGATTTCCAGCAACCTTGCGGGTGATCCCACCGCCGCAGCGGCGCTTCTCAGGCTTGCCTTCCACGACTGCCAAGTTGGA
GAG
TAAGTTCTTCGCACTGTTCTTTCCTTTCAGTCAGCTGAATTTCTGTTTCTTTCGTTGTCACCACCACCACCGGGAAAATCAAAACTCGTTTCTCTGTTCTCCGGCCCAGGGATGCGACGC
TTCCATCATGCTGAATTCGCAAGGTGGCATCACCAGCGAGATGGTTGCCTCCAAGAACTTTGGAATCCGGCGTCTCAACCTCATTGACAACGCGAAAGCGGCTGTGGACTCGCAATGCGG
GCCTGGCAGAGTTTCTTGTGCTGACATTATCGCCATGGCTGGAAGGGACGCCGTTGTCTTCGCAGGAGGCCCCGACTTTCGAATTCCCATGGGAAGGCTCGACAGCACGTTTGCTAGCAA
TGCCGCCGCCGATTCCAGCCTTCCACCGACGACCATCAGCGTTGATAATTTCCTCAACCTCTTTGGATCCATGGGCATGTCCACAGAAGAAAGCGTTGCAATTATGG
GGGTAAGTTCTTC
CAGTGTTCCTTAGAATTCCCTCTTCCAAAATTCTCATCTCCGTAAGTTCGTTGTCTCATCGGCTCTTAGAGTGGTTCTTTAAGTTCATCGTTCCAAAAGTTTTCATATCGGTAAGTTTCC
GCCAGAGTCCAAGTTTCAAAGTTCTCTGTTCGTCCGTTTCCGAGAGTCTCGATAAAGTTTCCCCGCGAGTGCACGTTTCTTAGTTTCAAGTTTCTCACGGATAAAAAACCTCGTTTCTTA
CCAACCAGGTGGCGGTCATACTCTCGGCGTCGGGCACTGCGTGAACATCGTCAACCGGCTCTATCCCAATGCGGAGTCGACCTTGAGCTTCGTATACGCGACTAGATTGCGAGTGAGCTG
CCCGTCCTCAGATCCCAGATTCATCATCAATGCCACTACTGTCCAGAACGATTTCAGCAGCCTTCAGTTCGACAATCAGTACTTTCGAGAGGCGACAATGGGTCTCGGACTCTTCACCAT
TGATGCAGCGCTGGCCAGTGACGCGAGAACTTCTCCGATAGTGGCCAGGTTCTCTCAGAACCAGAACTCTTTCTTCAATGCCTTCGCAAGTGCTTACGCGAAGCTCACTTCTTTCAACGT
ACTGACTGGAAATCGAGGTGAAGTGAGAAACAACTGCAGATTTGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCACAGCCTAACTGCATTGTCGTCTCGATGGAGGTGGAGCACTTTCCTGTTCTCGGCGATGATCCTGGCGGAGTTCTTCCCCCTGTCCCAGCAACTTTCGTACGATTACTACGAC
AACGTCTGTCCCCAGGCCGAAAGAACTGTGAGAGCTTCGATTTCCAGCAACCTTGCGGGTGATCCCACCGCCGCAGCGGCGCTTCTCAGGCTTGCCTTCCACGACTGCCAAGTTGGA
GGA
TGCGACGCTTCCATCATGCTGAATTCGCAAGGTGGCATCACCAGCGAGATGGTTGCCTCCAAGAACTTTGGAATCCGGCGTCTCAACCTCATTGACAACGCGAAAGCGGCTGTGGACTCG
CAATGCGGGCCTGGCAGAGTTTCTTGTGCTGACATTATCGCCATGGCTGGAAGGGACGCCGTTGTCTTCGCAGGAGGCCCCGACTTTCGAATTCCCATGGGAAGGCTCGACAGCACGTTT
GCTAGCAATGCCGCCGCCGATTCCAGCCTTCCACCGACGACCATCAGCGTTGATAATTTCCTCAACCTCTTTGGATCCATGGGCATGTCCACAGAAGAAAGCGTTGCAATTATGG
GTGGC
GGTCATACTCTCGGCGTCGGGCACTGCGTGAACATCGTCAACCGGCTCTATCCCAATGCGGAGTCGACCTTGAGCTTCGTATACGCGACTAGATTGCGAGTGAGCTGCCCGTCCTCAGAT
CCCAGATTCATCATCAATGCCACTACTGTCCAGAACGATTTCAGCAGCCTTCAGTTCGACAATCAGTACTTTCGAGAGGCGACAATGGGTCTCGGACTCTTCACCATTGATGCAGCGCTG
GCCAGTGACGCGAGAACTTCTCCGATAGTGGCCAGGTTCTCTCAGAACCAGAACTCTTTCTTCAATGCCTTCGCAAGTGCTTACGCGAAGCTCACTTCTTTCAACGTACTGACTGGAAAT
CGAGGTGAAGTGAGAAACAACTGCAGATTTGTGAACTAA

Retrieve as FASTA