Entry information : SmPrx11-2_41 (SmPrx11b_41)
Entry ID 7043
Creation 2009-10-15 (Paula Nunes)
Last sequence changes 2009-10-15 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx11-2_41 (SmPrx11b_41)
Name (synonym) SmPrx11-2_41 (SmPrx11b_41)
Class Class III peroxidase    [Orthogroup: Prx247]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx11-2_41
start..stop
S start..stop
SmPrx11-1_35 672 0 1..332 1..332
SmPrx12-1_113 423 7.33e-150 14..332 9..326
SmPrx12-2_55 420 1.13e-148 14..332 9..326
SmPrx52-2_1 372 1.84e-129 17..332 33..346
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7043' 'complement(join(1440744..1441147,1441418..1441775,1441886..1442122))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1441886..1442122 235 N° 2 1441418..1441775 356 N° 3 1440744..1441147 402  
complement(join(1440744..1441147,1441418..1441775,1441886..1442122))


exon

Literature and cross-references SmPrx11-2_41 (SmPrx11b_41)
DNA ref. Phytozome 12:   scaffold_41 (1442122..1440744)
mRNA ref. JGI transcript:   110943 [Incorrect prediction]
Protein sequence: SmPrx11-2_41 (SmPrx11b_41)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (299)
PWM (Da):   %s   35606.45 (31769.5)  
PI (pH):   %s   6.11 (5.72) Peptide Signal:   %s   cut: 34 range:34-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDHSLTALSSRWRWSTFLVSAMILAEFFPLSQQLSYDYYDNVCPQ
AERTVRASISSNLAGDPTAAAALLRLAFHDCQVG
GCDASIMLNSQGGITSEMVASKNFGIRRLNLIDNAKAAVDSQCGPGRVSCADIIAMAGRDAVVFAGGPDFRIPMGRLDSTFASNAAADSSLPPTTISVDNFLNLFGSMGMSTEESVAIMG
GGHTLGVGHCVNIVNRLYPNTESTLSFVYATRLRVSCPSSDPRFIINATTVQNDFSSLQFDNQYFREATMGLGLFTIDAALASDARTSPIVARFSQNQISFFNAFASAYAKLTSFNVLTG
NRGEVRNNCRFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3). No ESTs. Incorrect prediction (short SP).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCACAGCCTAACTGCATTGTCGTCTCGGTGGAGGTGGAGCACTTTCCTGGTCTCGGCGATGATCCTGGCGGAGTTCTTCCCCCTGTCCCAGCAACTTTCGTACGATTACTACGAC
AACGTCTGTCCCCAGGCCGAAAGAACTGTGAGAGCTTCGATTTCCAGCAACCTTGCGGGTGATCCCACCGCCGCAGCGGCGCTTCTCAGGCTTGCCTTCCACGACTGCCAAGTTGGA
GTA
AGTTCTTCGCACTGTTCTTTCCTTTCAGTCAGCTGAATTTCTGCTTCTTTCGTTGTCACCACCACCACCGGGAAAATCAAAACTCGTTTCTCTGTTCTCCGGCCCAGGGGGATGCGACGC
TTCCATCATGCTGAATTCGCAAGGTGGCATCACCAGCGAGATGGTTGCCTCCAAGAACTTTGGAATCCGGCGTCTCAACCTCATTGACAACGCGAAAGCGGCTGTGGACTCGCAATGCGG
GCCTGGCAGAGTTTCTTGTGCTGACATTATCGCCATGGCTGGAAGGGACGCCGTTGTCTTCGCAGGAGGCCCCGACTTTCGAATTCCCATGGGAAGGCTCGACAGCACGTTTGCTAGCAA
TGCCGCCGCCGATTCCAGCCTTCCACCGACGACCATCAGCGTTGATAATTTCCTCAACCTCTTTGGATCCATGGGCATGTCCACAGAAGAAAGCGTTGCAATTATGG
GTAAGTTCTTCCA
GTGTTCCTTAGAATTCCCTCTTCCAAAATTCCCATCTCCGTAAGTCCGTTGTCTCATCGGCTCTTAGAGTGGTTCTTTAAGTTCATCGTTCCAAAAGTTTTCATATCGGTAAGTTTCCGC
CAGAGTCCAAGTTTCAAAGTTCTCTGTTCGAGTTATAAATGTCCGTTTCCGAGAGTCTCGATAAAGTTTCCCCACGACTGCACGTTTCTTAGTTTCAAGTTTCTCACGGATAAAAAACCT
CGTTTCTTACCAACCAGGTGTGGCGGTCATACTCTCGGCGTCGGGCACTGCGTGAACATCGTCAACCGGCTCTATCCCAATACCGAGTCGACCTTGAGCTTCGTATACGCGACTAGATTG
CGAGTGAGCTGCCCGTCCTCAGATCCAAGATTCATCATCAATGCCACTACTGTCCAGAACGATTTCAGCAGCCTTCAGTTCGACAATCAGTACTTTCGAGAGGCGACAATGGGTCTCGGA
CTCTTCACCATTGATGCAGCGCTGGCCAGTGACGCGAGAACTTCTCCGATAGTGGCCAGGTTCTCTCAGAACCAGATCTCTTTCTTCAATGCCTTCGCAAGTGCTTACGCGAAGCTCACT
TCTTTCAACGTCCTGACTGGAAATCGAGGTGAAGTGAGAAACAACTGCAGATTTGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCACAGCCTAACTGCATTGTCGTCTCGGTGGAGGTGGAGCACTTTCCTGGTCTCGGCGATGATCCTGGCGGAGTTCTTCCCCCTGTCCCAGCAACTTTCGTACGATTACTACGAC
AACGTCTGTCCCCAGGCCGAAAGAACTGTGAGAGCTTCGATTTCCAGCAACCTTGCGGGTGATCCCACCGCCGCAGCGGCGCTTCTCAGGCTTGCCTTCCACGACTGCCAAGTTGGA
GGA
TGCGACGCTTCCATCATGCTGAATTCGCAAGGTGGCATCACCAGCGAGATGGTTGCCTCCAAGAACTTTGGAATCCGGCGTCTCAACCTCATTGACAACGCGAAAGCGGCTGTGGACTCG
CAATGCGGGCCTGGCAGAGTTTCTTGTGCTGACATTATCGCCATGGCTGGAAGGGACGCCGTTGTCTTCGCAGGAGGCCCCGACTTTCGAATTCCCATGGGAAGGCTCGACAGCACGTTT
GCTAGCAATGCCGCCGCCGATTCCAGCCTTCCACCGACGACCATCAGCGTTGATAATTTCCTCAACCTCTTTGGATCCATGGGCATGTCCACAGAAGAAAGCGTTGCAATTATGG
GTGGC
GGTCATACTCTCGGCGTCGGGCACTGCGTGAACATCGTCAACCGGCTCTATCCCAATACCGAGTCGACCTTGAGCTTCGTATACGCGACTAGATTGCGAGTGAGCTGCCCGTCCTCAGAT
CCAAGATTCATCATCAATGCCACTACTGTCCAGAACGATTTCAGCAGCCTTCAGTTCGACAATCAGTACTTTCGAGAGGCGACAATGGGTCTCGGACTCTTCACCATTGATGCAGCGCTG
GCCAGTGACGCGAGAACTTCTCCGATAGTGGCCAGGTTCTCTCAGAACCAGATCTCTTTCTTCAATGCCTTCGCAAGTGCTTACGCGAAGCTCACTTCTTTCAACGTCCTGACTGGAAAT
CGAGGTGAAGTGAGAAACAACTGCAGATTTGTGAACTAA

Retrieve as FASTA