Entry information : SmPrx71-1_4 (SmPrx71a_4)
Entry ID 7048
Creation 2009-10-18 (Paula Nunes)
Last sequence changes 2009-10-18 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx71-1_4 (SmPrx71a_4)
Name (synonym) SmPrx71-1_4 (SmPrx71a_4)
Class Class III peroxidase    [Orthogroup: Prx249]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx71-1_4
start..stop
S start..stop
SmPrx71-2_98 637 0 1..319 1..319
SmPrx91-1_24 414 2.32e-146 10..319 12..322
SmPrx91-2_26 412 5.56e-146 10..319 12..322
SmPrx58-1_129 384 8.83e-135 7..319 3..315
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7048' 'join(3557968..3558171,3558242..3558424,3558490..3559062)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3557968..3558171 202 N° 2 3558242..3558424 181 N° 3 3558490..3559062 571  
join(3557968..3558171,3558242..3558424,3558490..3559062)


exon

Literature and cross-references SmPrx71-1_4 (SmPrx71a_4)
DNA ref. Phytozome 12:   scaffold_4 (3557968..3559062)
mRNA ref. JGI transcript:   81737
Protein sequence: SmPrx71-1_4 (SmPrx71a_4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (298)
PWM (Da):   %s   33827.72 (31676.6)  
PI (pH):   %s   5.53 (5.53) Peptide Signal:   %s   cut: 22 range:22-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACKLLFLAFLALSLGDCALGALSSSFYATSCPNLTNIVHAAVQQ
VVASEPRMCASLIRLFFHDCHVN
GCDASILLAGASLEQNAFPNINSVRGYDVVNNIKALIEAQCPGKVSCADELVLIAQQCVTALGGPSWSVLFGRRDSLNASQSAANTNLPPPTFNVSALIANFKAHGLSLQDMVALSGAHT
VGKSHCSSFKPRLYGPFQAPDAMNPTFNTSLQGQCPNVSSSDNNLVDLDQLTPVVFDNKYFVDLLNGTGVLFSDETLAIGGNSTAESLVWTYASNQTRFFLDFVTGMINMGNESPLQAPN
GQIRLNCSRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGTAAACTTCTCTTCCTTGCATTCCTAGCTTTAAGCCTAGGTGATTGTGCACTGGGAGCTCTCAGCTCCTCGTTCTACGCCACCTCATGCCCGAATCTCACCAACATCGTGCAT
GCCGCAGTGCAGCAGGTCGTTGCGTCCGAACCCAGAATGTGTGCTTCGCTAATCCGCCTCTTCTTCCACGATTGTCATGTGAAC
ACGTAAGCTCGAACATCGCATTTTCCTTCTTTTAAA
TGATATAAACTCTGGAATTCAATGGATCATATGCAGGGCTGCGATGCGTCGATTCTCTTGGCCGGAGCGAGCCTCGAGCAGAACGCGTTCCCGAACATAAACTCGGTGCGAGGATACGAC
GTTGTCAACAACATCAAGGCTCTCATCGAGGCCCAGTGCCCCGGGAAGGTGTCTTGCGCGGACGAGCTCGTCTTGATCGCCCAACAATGCGTCACCGCA
CAGTGCGTATATCAACAATGA
TATATCCCATGATCATTTACTAATTGATTTTCCATGCTACGTGCAGCTTGGAGGCCCATCCTGGAGCGTCCTCTTCGGACGAAGGGACAGCCTAAACGCGAGCCAGTCGGCAGCGAACAC
AAACCTCCCACCTCCCACCTTCAACGTCTCGGCGCTCATCGCAAACTTCAAGGCCCACGGCCTGTCGCTCCAGGACATGGTCGCCCTCTCTGGAGCCCACACCGTCGGGAAATCCCACTG
CTCCAGCTTCAAGCCCCGCCTCTACGGCCCCTTCCAGGCCCCGGACGCCATGAATCCCACCTTCAACACTTCGCTGCAGGGCCAGTGCCCCAACGTGAGCTCCAGCGACAACAATCTCGT
GGATCTGGACCAGCTCACGCCGGTGGTGTTCGACAACAAGTATTTCGTGGATCTCTTGAACGGCACCGGGGTGCTCTTCTCGGACGAGACGCTCGCCATCGGTGGCAACTCCACTGCCGA
GTCGCTGGTGTGGACTTATGCATCCAACCAGACGCGCTTCTTCCTGGATTTCGTGACTGGGATGATCAACATGGGGAACGAGAGCCCGCTCCAAGCTCCGAATGGACAGATCCGGCTCAA
TTGCTCCCGGGTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTGTAAACTTCTCTTCCTTGCATTCCTAGCTTTAAGCCTAGGTGATTGTGCACTGGGAGCTCTCAGCTCCTCGTTCTACGCCACCTCATGCCCGAATCTCACCAACATCGTGCAT
GCCGCAGTGCAGCAGGTCGTTGCGTCCGAACCCAGAATGTGTGCTTCGCTAATCCGCCTCTTCTTCCACGATTGTCATGTGAAC
GGCTGCGATGCGTCGATTCTCTTGGCCGGAGCGAGC
CTCGAGCAGAACGCGTTCCCGAACATAAACTCGGTGCGAGGATACGACGTTGTCAACAACATCAAGGCTCTCATCGAGGCCCAGTGCCCCGGGAAGGTGTCTTGCGCGGACGAGCTCGTC
TTGATCGCCCAACAATGCGTCACCGCA
CTTGGAGGCCCATCCTGGAGCGTCCTCTTCGGACGAAGGGACAGCCTAAACGCGAGCCAGTCGGCAGCGAACACAAACCTCCCACCTCCCACC
TTCAACGTCTCGGCGCTCATCGCAAACTTCAAGGCCCACGGCCTGTCGCTCCAGGACATGGTCGCCCTCTCTGGAGCCCACACCGTCGGGAAATCCCACTGCTCCAGCTTCAAGCCCCGC
CTCTACGGCCCCTTCCAGGCCCCGGACGCCATGAATCCCACCTTCAACACTTCGCTGCAGGGCCAGTGCCCCAACGTGAGCTCCAGCGACAACAATCTCGTGGATCTGGACCAGCTCACG
CCGGTGGTGTTCGACAACAAGTATTTCGTGGATCTCTTGAACGGCACCGGGGTGCTCTTCTCGGACGAGACGCTCGCCATCGGTGGCAACTCCACTGCCGAGTCGCTGGTGTGGACTTAT
GCATCCAACCAGACGCGCTTCTTCCTGGATTTCGTGACTGGGATGATCAACATGGGGAACGAGAGCCCGCTCCAAGCTCCGAATGGACAGATCCGGCTCAATTGCTCCCGGGTCAATTGA

Retrieve as FASTA