Entry information : SmPrx51-1_16 (SmPrx51a_16)
Entry ID 7056
Creation 2009-10-19 (Christophe Dunand)
Last sequence changes 2009-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx51-1_16 (SmPrx51a_16)
Name (synonym) SmPrx51-1_16 (SmPrx51a_16)
Class Class III peroxidase    [Orthogroup: Prx296]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx51-1_16
start..stop
S start..stop
SmPrx51-2_1 704 0 1..350 1..350
WmPrx08 348 8e-120 31..347 19..333
GbPrx12 345 6e-119 43..347 33..334
CmichPrx01 342 4e-117 41..347 58..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1844971..1845234 264 N° 2 1845303..1845494 192 N° 3 1845623..1846219 597  
join(1844971..1845234,1845303..1845494,1845623..1846219)


exon

Literature and cross-references SmPrx51-1_16 (SmPrx51a_16)
DNA ref. Phytozome 12:   scaffold_16 (1844971..1846219)
mRNA ref. JGI transcript:   411941 [Incorrect splicing]
Protein sequence: SmPrx51-1_16 (SmPrx51a_16)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (331)
PWM (Da):   %s   38205.08 (36222.9)  
PI (pH):   %s   4.86 (4.78) Peptide Signal:   %s   cut: 23 range:20-350
Sequence 391
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLNLAIISLVFLGTVLGSRGQYEYDDDNVVAISENSTLYGLSEDFYRHACPQVYSIVRAGVEAAIKIQQRNAASLLRLFFHDCFVQGCDASLLLDDAPFFIGEKTAAANNQSARGFEFIDVIKASVEEACPLTVSCADILAIVARDAVVLSGGPNWEVALGRRDSLTASRAASDHFIPDPTYDLPQLLSSFQAMGLGAEDLVSLVGAHTMGFSRCTSFEQRIYNQSGTHHPDLNIEPGFLKQLHDRCPPHGDPNTLQPLDWESPASFDNGYYKNLVSQSAVLHSDGTLYSEAIAGFAGIRELVEKFAEDEQAFFASFARSIVRMGNLRPLIGDKGEVRKNCRRVNPKF

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST. Incorrect prediction from JGI (extra 3' introns => increasing size).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCAGGCTCAATTTGGCTATCATCTCGCTGGTGTTCTTGGGTACCGTACTGGGATCAAGAGGGCAGTACGAGTACGACGATGACAACGTTGTTGCCATTAGCGAGAACAGTACGCTGT
ACGGACTGAGCGAGGATTTCTATAGGCACGCTTGTCCCCAGGTCTACTCCATCGTCAGGGCTGGAGTGGAGGCCGCGATTAAGATCCAGCAGCGCAATGCGGCATCGCTGCTACGCCTCT
TCTTCCACGACTGCTTCGTCCAA
GTAAAGCTCTCTTAACCCTGGATTGATCGATAGAACGATAGCTGCTCAATGCTTTTCTTTACTTCCAGGGATGCGATGCGTCGCTGCTCCTCGATGA
CGCGCCCTTCTTCATCGGCGAGAAAACTGCCGCCGCCAACAATCAATCGGCTCGAGGATTCGAGTTCATCGACGTGATCAAAGCGAGCGTCGAGGAAGCGTGCCCTCTCACCGTCTCCTG
CGCTGATATTCTCGCCATCGTGGCCAGGGACGCCGTTGTCTTG
GTAAGCATGTGAACTTCCCCTCTTGTTTCCTCCTATTTCCCTCTGGTTACCCCCGCATTGCCTTTTTTCCCTCTATT
TCCCTCGTGTTTTCCCAGAATTTCTGACGCACGGCGCTATGACATGGACAGAGTGGAGGACCCAACTGGGAAGTAGCGCTCGGGCGGAGGGACAGCCTCACGGCGAGCCGAGCAGCGTCG
GATCATTTCATCCCGGATCCCACGTACGATCTCCCCCAACTTCTCTCATCCTTCCAGGCGATGGGCCTGGGCGCCGAGGATCTAGTCTCGCTCGTCGGAGCTCACACAATGGGCTTCTCG
CGATGTACGAGCTTTGAGCAGCGGATCTACAACCAGAGCGGAACCCACCACCCGGATCTTAACATCGAGCCCGGGTTTCTCAAGCAGCTCCACGATCGATGCCCGCCCCACGGCGATCCA
AACACGCTCCAGCCCCTCGACTGGGAGTCCCCGGCCTCATTCGACAATGGCTACTACAAGAACTTGGTGTCCCAAAGCGCGGTGCTCCACTCGGACGGGACGCTCTACTCGGAGGCGATC
GCGGGGTTTGCAGGGATTCGCGAGCTCGTGGAGAAGTTTGCCGAGGACGAGCAGGCATTCTTCGCGAGCTTTGCGAGATCGATCGTGAGGATGGGGAACTTGAGGCCGCTGATCGGGGAC
AAGGGCGAGGTGAGAAAGAACTGCCGGAGAGTGAACCCCAAGTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCAGGCTCAATTTGGCTATCATCTCGCTGGTGTTCTTGGGTACCGTACTGGGATCAAGAGGGCAGTACGAGTACGACGATGACAACGTTGTTGCCATTAGCGAGAACAGTACGCTGT
ACGGACTGAGCGAGGATTTCTATAGGCACGCTTGTCCCCAGGTCTACTCCATCGTCAGGGCTGGAGTGGAGGCCGCGATTAAGATCCAGCAGCGCAATGCGGCATCGCTGCTACGCCTCT
TCTTCCACGACTGCTTCGTCCAA
GGATGCGATGCGTCGCTGCTCCTCGATGACGCGCCCTTCTTCATCGGCGAGAAAACTGCCGCCGCCAACAATCAATCGGCTCGAGGATTCGAGTTCA
TCGACGTGATCAAAGCGAGCGTCGAGGAAGCGTGCCCTCTCACCGTCTCCTGCGCTGATATTCTCGCCATCGTGGCCAGGGACGCCGTTGTCTTG
AGTGGAGGACCCAACTGGGAAGTAG
CGCTCGGGCGGAGGGACAGCCTCACGGCGAGCCGAGCAGCGTCGGATCATTTCATCCCGGATCCCACGTACGATCTCCCCCAACTTCTCTCATCCTTCCAGGCGATGGGCCTGGGCGCCG
AGGATCTAGTCTCGCTCGTCGGAGCTCACACAATGGGCTTCTCGCGATGTACGAGCTTTGAGCAGCGGATCTACAACCAGAGCGGAACCCACCACCCGGATCTTAACATCGAGCCCGGGT
TTCTCAAGCAGCTCCACGATCGATGCCCGCCCCACGGCGATCCAAACACGCTCCAGCCCCTCGACTGGGAGTCCCCGGCCTCATTCGACAATGGCTACTACAAGAACTTGGTGTCCCAAA
GCGCGGTGCTCCACTCGGACGGGACGCTCTACTCGGAGGCGATCGCGGGGTTTGCAGGGATTCGCGAGCTCGTGGAGAAGTTTGCCGAGGACGAGCAGGCATTCTTCGCGAGCTTTGCGA
GATCGATCGTGAGGATGGGGAACTTGAGGCCGCTGATCGGGGACAAGGGCGAGGTGAGAAAGAACTGCCGGAGAGTGAACCCCAAGTTCTAA

Retrieve as FASTA