Entry information : SmPrx36-1_2 (SmPrx36a_2)
Entry ID 7058
Creation 2009-10-19 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-26 (Toky Ramarohetra)
Peroxidase information: SmPrx36-1_2 (SmPrx36a_2)
Name (synonym) SmPrx36-1_2 (SmPrx36a_2)
Class Class III peroxidase    [Orthogroup: Prx069]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx36-1_2
start..stop
S start..stop
SmPrx36-2_44 768 0 1..376 1..376
SmPrx37-2_44 466 1.16e-165 78..376 44..343
SmPrx37-1_2 464 2.67e-165 78..376 42..341
SmPrx34-1_84 425 1.05e-149 71..375 22..328
Gene structure Fichier Exons


exon

Literature and cross-references SmPrx36-1_2 (SmPrx36a_2)
DNA ref. Phytozome 12:   scaffold_2 (3177337..3178574)
mRNA ref. JGI transcript:   28740 [Incorrect splicing]  39794 [Incorrect splicing]
Protein sequence: SmPrx36-1_2 (SmPrx36a_2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   376
PWM (Da):   %s   41130.85  
PI (pH):   %s   9.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLFVPSQEIHRPVVTSYQETLSISSPTGLPRRSFYAPFQYKRPRLLDPSLCVLEQRKMKFVFVLCICLVSAAAQLSPTFYDSSCPKLLSTVRSVLERAVQREPRMAASLLRLHFHDCFVNGCDGSVLLDDKPGFRGEKTSNPNRNSARGFEVVDSVKAAVERVCPGVVSCADILAIIAEQSVVLMNGPSWTILLGRRDSTTASLAASNNDIPPPTSTLSQLISKFQAKGLSVQELVALSG
SHTIGQARCTSFKDRLYNFSNTARPDSNFNQGYLKTLQRKCPRSGGDNNTSPLDFQTPTGFDNAYFSNIVANEGLLNSDQVLYAPSGSSSRIVSNYEDNPSLFFRDFANAMVKMGNLSPL
TGKSGQIRKNCRVVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST. Incorrect prediction from JGI => Two fragments.
DNA
Send to BLAST
CDS
Send to BLAST