Entry information : SmPrx36-2_44 (SmPrx36b_44)
Entry ID 7059
Creation 2009-10-19 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-26 (Toky Ramarohetra)
Peroxidase information: SmPrx36-2_44 (SmPrx36b_44)
Name (synonym) SmPrx36-2_44 (SmPrx36b_44)
Class Class III peroxidase    [Orthogroup: Prx069]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx36-2_44
start..stop
S start..stop
SmPrx36-1_2 768 0 1..376 1..376
SmPrx37-2_44 466 9.47e-166 78..376 44..343
SmPrx37-1_2 465 2.46e-165 78..376 42..341
SmPrx34-1_84 425 1.03e-149 71..375 22..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7059' 'complement(join(1223283..1223861,1223913..1224104,1224161..1224520))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1224161..1224520 358 N° 2 1223913..1224104 190 N° 3 1223283..1223861 577  
complement(join(1223283..1223861,1223913..1224104,1224161..1224520))


exon

Literature and cross-references SmPrx36-2_44 (SmPrx36b_44)
DNA ref. Phytozome 12:   scaffold_44 (1224520..1223283)
mRNA ref. JGI transcript:   18774 [Incorrect splicing]  39796 [Incorrect splicing]
Protein sequence: SmPrx36-2_44 (SmPrx36b_44)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   376
PWM (Da):   %s   41102.82  
PI (pH):   %s   9.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLFAPSQEIHRPVVTSYQETLSISSPTGLPRRSFYAPFQYKRPRLLDPSLCVLEQRKMKFVFVLCICLVSAAAQLSPTFYDSSCPKLLSTVRSVLERAVQREPRMAASLLRLHFHDCFVN
GCDGSVLLDDKPGFRGEKTSNPNRNSARGFEVVDSVKAAVERVCPGVVSCADILAIIAEQSVVLMNGPSWTILLGRRDSTTASLAASNNDIPPPTSTLSQLISKFQAKGLSVQELVALSG
SHTIGQARCTSFKDRLYNFSNTARPDSNFNQGYLKTLQRKCPRSGGDNNTSPLDFQTPTGFDNAYFSNIVANEGLLNSDQVLYAPSGSSSRIVSNYEDNPSLFFRDFANAMVKMGNLSPL
TGKSGQIRKNCRVVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST. Incorrect prediction from JGI => Two fragments.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTTTGCACCAAGTCAAGAGATTCACCGACCAGTAGTAACAAGCTACCAGGAAACTTTGTCGATTAGTTCTCCCACTGGCCTTCCCCGTCGGTCTTTCTACGCACCTTTCCAGTAT
AAAAGGCCACGACTTCTCGATCCGTCCTTGTGCGTTCTCGAGCAAAGAAAAATGAAGTTTGTGTTTGTTCTTTGCATCTGCCTTGTCTCAGCCGCTGCTCAGCTGAGCCCCACCTTCTAT
GACTCGTCGTGTCCGAAGCTGTTATCAACTGTGAGAAGTGTACTTGAGAGAGCTGTTCAGAGGGAACCACGCATGGCTGCCTCGCTTCTGCGTCTCCATTTCCACGACTGTTTTGTCAAT
GTAAGTCGATGTGACCGTCTTGCAAGCTGAAACACTGTATGTTCTGCCAGGGATGCGAGATGGATCTGTCCTCCTCGACGACAAGCCGGGATTTCGAGGCGAAAAAACTTCCAACCCGAA
CAGGAACTCGGCGAGAGGATTCGAGGTGGTGGACAGCGTGAAAGCAGCGGTTGAGAGAGTCTGTCCTGGAGTTGTATCTTGCGCCGATATTCTAGCGATTATAGCTGAACAAAGCGTTGT
CTTGGTAAGA
ACCCGGTTGCTCGAGCTTGAAAGAAATGAGCTGACGAGATTCTTGTAACAGATATGAATGGACCATCTTGGACAATACTGTTGGGACGTCGGGATAGCACGACCGCGAGC
TTGGCCGCCTCTAACAACGATATACCGCCTCCAACCTCCACCCTTTCCCAGCTTATTTCCAAGTTCCAGGCCAAGGGACTTTCTGTGCAAGAGCTAGTCGCACTCTCTGGAAGTCACACC
ATCGGACAAGCTCGTTGCACAAGCTTTAAGGATCGTCTGTATAATTTCAGCAACACCGCCAGGCCGGATTCAAATTTCAACCAAGGATACTTGAAGACCCTGCAAAGAAAATGCCCACGT
TCAGGAGGTGACAACAATACTTCTCCACTAGATTTCCAGACCCCCACCGGCTTTGACAATGCGTACTTTAGTAACATTGTTGCCAACGAGGGTCTTCTCAACTCCGATCAAGTGCTGTAC
GCACCTTCAGGATCGTCAAGCAGAATTGTCTCCAACTACGAAGACAACCCGAGCCTATTCTTCAGGGACTTCGCGAATGCCATGGTGAAGATGGGAAACCTGAGTCCTCTAACTGGAAAA
AGCGGTCAGATTCGCAAGAACTGCCGTGTGGTGAACAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTTTGCACCAAGTCAAGAGATTCACCGACCAGTAGTAACAAGCTACCAGGAAACTTTGTCGATTAGTTCTCCCACTGGCCTTCCCCGTCGGTCTTTCTACGCACCTTTCCAGTAT
AAAAGGCCACGACTTCTCGATCCGTCCTTGTGCGTTCTCGAGCAAAGAAAAATGAAGTTTGTGTTTGTTCTTTGCATCTGCCTTGTCTCAGCCGCTGCTCAGCTGAGCCCCACCTTCTAT
GACTCGTCGTGTCCGAAGCTGTTATCAACTGTGAGAAGTGTACTTGAGAGAGCTGTTCAGAGGGAACCACGCATGGCTGCCTCGCTTCTGCGTCTCCATTTCCACGACTGTTTTGTCAAT
GATGGATCTGTCCTCCTCGACGACAAGCCGGGATTTCGAGGCGAAAAAACTTCCAACCCGAACAGGAACTCGGCGAGAGGATTCGAGGTGGTGGACAGCGTGAAAGCAGCGGTTGAGAGA
GTCTGTCCTGGAGTTGTATCTTGCGCCGATATTCTAGCGATTATAGCTGAACAAAGCGTTGTCTTGGTAAGA
ATGAATGGACCATCTTGGACAATACTGTTGGGACGTCGGGATAGCACG
ACCGCGAGCTTGGCCGCCTCTAACAACGATATACCGCCTCCAACCTCCACCCTTTCCCAGCTTATTTCCAAGTTCCAGGCCAAGGGACTTTCTGTGCAAGAGCTAGTCGCACTCTCTGGA
AGTCACACCATCGGACAAGCTCGTTGCACAAGCTTTAAGGATCGTCTGTATAATTTCAGCAACACCGCCAGGCCGGATTCAAATTTCAACCAAGGATACTTGAAGACCCTGCAAAGAAAA
TGCCCACGTTCAGGAGGTGACAACAATACTTCTCCACTAGATTTCCAGACCCCCACCGGCTTTGACAATGCGTACTTTAGTAACATTGTTGCCAACGAGGGTCTTCTCAACTCCGATCAA
GTGCTGTACGCACCTTCAGGATCGTCAAGCAGAATTGTCTCCAACTACGAAGACAACCCGAGCCTATTCTTCAGGGACTTCGCGAATGCCATGGTGAAGATGGGAAACCTGAGTCCTCTA
ACTGGAAAAAGCGGTCAGATTCGCAAGAACTGCCGTGTGGTGAACAGCTAG

Retrieve as FASTA