Entry information : SmPrx75-1_52 (SmPrx75a_52)
Entry ID 7061
Creation 2009-10-19 (Paula Nunes)
Last sequence changes 2009-10-19 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx75-1_52 (SmPrx75a_52)
Name (synonym) SmPrx75-1_52 (SmPrx75a_52)
Class Class III peroxidase    [Orthogroup: Prx078]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx75-1_52
start..stop
S start..stop
SmPrx75-2_233 672 0 1..328 1..328
SmPrx50-1_126 389 2e-136 3..327 2..327
SmPrx50-2_101 387 9e-136 3..327 2..327
QsPrx02 379 2e-132 8..327 15..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 529019..529231 213 N° 2 528753..528944 192 N° 3 528106..528687 582  
complement(join(528106..528687,528753..528944,529019..529231))


exon

Literature and cross-references SmPrx75-1_52 (SmPrx75a_52)
DNA ref. Phytozome 12:   scaffold_52 (529231..528106)
mRNA ref. JGI transcript:   421525
Protein sequence: SmPrx75-1_52 (SmPrx75a_52)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (304)
PWM (Da):   %s   34916.32 (32542.0)  
PI (pH):   %s   7.32 (6.35) Peptide Signal:   %s   cut: 25 range:25-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKAAKTLCVAIASLVILSASTCAQLSPSFYNGTCRDVSHVVWKVVSQAVGNEKRMAASLLRLHFHDCFVNGCDGSVLLDDTASFTGEKSAGPNKNSLRGFEVIDAIKSQLESQCPGIVSCADIVALAAQTSVFMLGGPGWAVPLGRRDSTTASRDAANSQIPPPVFTVSELTSAFQAKGLSLKDMVVLSGAHTIGAAQCFTFRNRLYSFNSTAASDPTIDASFLATLQSSCPKESGDDQLSNLDAVTPNRFDNQYYKNLQKNKGLLTSDQELFSGTGSDAATLVSSYASNPLTFWRDFKESMIKMGDISPLTGTNGEIRKNCHFVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAAAAGCAGCCAAAACCTTGTGTGTGGCTATAGCATCTCTTGTGATATTGTCGGCAAGTACTTGTGCGCAGCTTAGCCCTTCATTTTACAACGGTACTTGTCGCGATGTGTCTCAT
GTTGTTTGGAAAGTGGTGTCTCAGGCTGTTGGAAATGAGAAACGAATGGCAGCCTCCCTGCTAAGGCTCCACTTCCACGACTGCTTTGTCAAT
GTAAGGAGCCGCTAACCTTTAGAATTC
AGTGCTTCAAATTGTTTAAAAGTAACACTCACTTGTGCATTCGCCAGGGATGCGATGGCTCCGTTCTTTTGGATGACACTGCAAGCTTCACGGGAGAAAAGTCGGCAGGACCAAATAAGA
ACTCTTTACGAGGATTCGAAGTCATTGATGCTATCAAGAGCCAATTGGAGAGCCAGTGTCCGGGAATAGTCTCCTGCGCGGATATCGTAGCACTGGCAGCACAAACTTCTGTCTTCATG
G
TAAGATAGTGAGTTTTTGAACCATAGAGGAGGAGAAACTCACGTATATGTTGCGCTATAAACAGCTCGGAGGTCCAGGATGGGCCGTTCCTTTGGGACGGCGAGACAGTACCACGGCCAG
CCGTGATGCAGCCAACAGCCAAATTCCACCCCCGGTTTTCACAGTCTCGGAGCTCACATCCGCATTTCAGGCCAAGGGTCTGTCACTTAAGGACATGGTCGTGTTGTCCGGCGCTCATAC
TATCGGTGCTGCGCAGTGCTTTACTTTCCGCAACCGCCTCTATAGCTTCAACAGCACAGCCGCTTCGGATCCAACCATCGACGCTTCGTTTCTAGCAACTCTCCAAAGCAGCTGTCCCAA
GGAGTCCGGTGATGACCAGCTTTCAAACCTGGATGCTGTAACACCCAACCGGTTCGACAATCAGTACTACAAAAACTTGCAGAAAAATAAGGGACTGCTGACGTCTGACCAGGAATTGTT
CTCCGGCACCGGCTCGGACGCAGCGACACTGGTGAGCTCGTACGCAAGTAACCCGCTCACATTCTGGCGGGATTTCAAGGAGTCGATGATCAAAATGGGAGACATCAGCCCTCTCACAGG
CACAAACGGAGAGATCCGTAAGAACTGCCACTTTGTGAACAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAAAAGCAGCCAAAACCTTGTGTGTGGCTATAGCATCTCTTGTGATATTGTCGGCAAGTACTTGTGCGCAGCTTAGCCCTTCATTTTACAACGGTACTTGTCGCGATGTGTCTCAT
GTTGTTTGGAAAGTGGTGTCTCAGGCTGTTGGAAATGAGAAACGAATGGCAGCCTCCCTGCTAAGGCTCCACTTCCACGACTGCTTTGTCAAT
GGATGCGATGGCTCCGTTCTTTTGGAT
GACACTGCAAGCTTCACGGGAGAAAAGTCGGCAGGACCAAATAAGAACTCTTTACGAGGATTCGAAGTCATTGATGCTATCAAGAGCCAATTGGAGAGCCAGTGTCCGGGAATAGTCTCC
TGCGCGGATATCGTAGCACTGGCAGCACAAACTTCTGTCTTCATG
CTCGGAGGTCCAGGATGGGCCGTTCCTTTGGGACGGCGAGACAGTACCACGGCCAGCCGTGATGCAGCCAACAGC
CAAATTCCACCCCCGGTTTTCACAGTCTCGGAGCTCACATCCGCATTTCAGGCCAAGGGTCTGTCACTTAAGGACATGGTCGTGTTGTCCGGCGCTCATACTATCGGTGCTGCGCAGTGC
TTTACTTTCCGCAACCGCCTCTATAGCTTCAACAGCACAGCCGCTTCGGATCCAACCATCGACGCTTCGTTTCTAGCAACTCTCCAAAGCAGCTGTCCCAAGGAGTCCGGTGATGACCAG
CTTTCAAACCTGGATGCTGTAACACCCAACCGGTTCGACAATCAGTACTACAAAAACTTGCAGAAAAATAAGGGACTGCTGACGTCTGACCAGGAATTGTTCTCCGGCACCGGCTCGGAC
GCAGCGACACTGGTGAGCTCGTACGCAAGTAACCCGCTCACATTCTGGCGGGATTTCAAGGAGTCGATGATCAAAATGGGAGACATCAGCCCTCTCACAGGCACAAACGGAGAGATCCGT
AAGAACTGCCACTTTGTGAACAGTTGA

Retrieve as FASTA