Entry information : SmPrx75-2_233 (SmPrx75b_233)
Entry ID 7062
Creation 2009-10-22 (Paula Nunes)
Last sequence changes 2009-10-22 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx75-2_233 (SmPrx75b_233)
Name (synonym) SmPrx75-2_233 (SmPrx75b_233)
Class Class III peroxidase    [Orthogroup: Prx078]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx75-2_233
start..stop
S start..stop
SmPrx75-1_52 672 0 1..328 1..328
SmPrx50-1_126 391 3e-137 3..327 2..327
SmPrx50-2_101 389 2e-136 3..327 2..327
PabPrx20 381 2e-133 7..327 15..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14854..15066 213 N° 2 15142..15333 192 N° 3 15399..15980 582  
join(14854..15066,15142..15333,15399..15980)


exon

Literature and cross-references SmPrx75-2_233 (SmPrx75b_233)
DNA ref. Phytozome 12:   scaffold_233 (14854..15980)
mRNA ref. JGI transcript:   7760 [Incorrect prediction]
Protein sequence: SmPrx75-2_233 (SmPrx75b_233)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (304)
PWM (Da):   %s   34888.33 (32514.0)  
PI (pH):   %s   7.64 (6.65) Peptide Signal:   %s   cut: 25 range:25-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKAAKTLCVAIASLVILSASTCAQLSPSFYNGTCRDVSHVVWKVVSQAVGSEKRMAASLLRLHFHDCFVNGCDGSVLLDDTASFTGEKSAGPNKNSLRGFEVIDAIKSQLESQCPGIVSCADIVALAAQTSVFMLGGPGWAVPLGRRDSTTASRDAANSQIPPPVFTVSELTSAFQAKGLSLKDMVVLSGAHTIGAAQCFTFRNRLYSFNSTAASDPTIDASFLATLQSSCPKESGDDQLSNLDAVTPNRFDNQYYKNLQKNKGLLTSDQELFSGTGSDAATLVSSYASNPLTFWRDFKESMIKMGNISPLTGTNGEIRKNCHFVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No ESTs. Incorrect transcript prediction in JGI (the prediction runs from FHDC to VALS without exon 1 and 4).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAAAAGCAGCCAAAACCTTGTGTGTGGCTATAGCATCTCTTGTGATATTGTCGGCAAGTACTTGTGCGCAGCTTAGCCCTTCATTTTACAACGGTACTTGTCGCGATGTGTCTCAT
GTTGTTTGGAAAGTGGTGTCTCAGGCTGTTGGAAGTGAGAAACGAATGGCAGCCTCCCTGCTAAGGCTCCACTTCCACGACTGCTTTGTCAAT
GTAAGGAGCCGCTAACCCTTTAGAATT
CAGTGCTTCAAATTGTTTAAAAGTAACACTCACTTGTGCATTTGCCAGGGATGCGATGGCTCCGTTCTTTTGGATGACACTGCAAGCTTCACGGGAGAAAAGTCGGCAGGACCAAATAAG
AACTCTTTACGAGGATTCGAAGTCATTGATGCTATCAAGAGCCAATTGGAGAGCCAGTGTCCGGGAATAGTCTCCTGCGCGGACATCGTAGCACTGGCAGCACAAACTTCTGTCTTCATG
GTAAGATAGTGAGTTTTTGAACCATAGAGGAGGAGAAACTCACGTATATGTTGCGCTATAAACAGCTCGGAGGTCCAGGATGGGCCGTTCCTTTGGGACGGCGAGACAGTACCACGGCCA
GCCGTGATGCAGCCAACAGCCAAATTCCACCCCCGGTTTTCACAGTCTCGGAGCTCACATCCGCATTTCAGGCCAAGGGTCTGTCACTTAAGGACATGGTCGTGTTGTCCGGCGCTCATA
CAATCGGTGCTGCGCAGTGTTTTACTTTCCGCAACCGCCTCTATAGCTTCAACAGCACAGCCGCTTCGGACCCAACCATCGACGCTTCGTTTCTAGCAACTCTCCAAAGCAGCTGTCCCA
AGGAGTCCGGTGATGACCAGCTTTCAAACCTGGATGCTGTAACACCCAACCGGTTCGACAATCAGTACTACAAAAACTTGCAGAAAAACAAGGGACTGCTGACGTCTGACCAGGAATTGT
TCTCCGGCACCGGCTCGGACGCAGCGACACTGGTGAGCTCGTACGCCAGTAACCCGCTCACATTCTGGCGGGATTTCAAGGAGTCGATGATAAAAATGGGAAACATCAGCCCTCTCACAG
GCACAAACGGAGAGATCCGTAAGAACTGCCACTTTGTGAACAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAAAAGCAGCCAAAACCTTGTGTGTGGCTATAGCATCTCTTGTGATATTGTCGGCAAGTACTTGTGCGCAGCTTAGCCCTTCATTTTACAACGGTACTTGTCGCGATGTGTCTCAT
GTTGTTTGGAAAGTGGTGTCTCAGGCTGTTGGAAGTGAGAAACGAATGGCAGCCTCCCTGCTAAGGCTCCACTTCCACGACTGCTTTGTCAAT
GGATGCGATGGCTCCGTTCTTTTGGAT
GACACTGCAAGCTTCACGGGAGAAAAGTCGGCAGGACCAAATAAGAACTCTTTACGAGGATTCGAAGTCATTGATGCTATCAAGAGCCAATTGGAGAGCCAGTGTCCGGGAATAGTCTCC
TGCGCGGACATCGTAGCACTGGCAGCACAAACTTCTGTCTTCATG
CTCGGAGGTCCAGGATGGGCCGTTCCTTTGGGACGGCGAGACAGTACCACGGCCAGCCGTGATGCAGCCAACAGC
CAAATTCCACCCCCGGTTTTCACAGTCTCGGAGCTCACATCCGCATTTCAGGCCAAGGGTCTGTCACTTAAGGACATGGTCGTGTTGTCCGGCGCTCATACAATCGGTGCTGCGCAGTGT
TTTACTTTCCGCAACCGCCTCTATAGCTTCAACAGCACAGCCGCTTCGGACCCAACCATCGACGCTTCGTTTCTAGCAACTCTCCAAAGCAGCTGTCCCAAGGAGTCCGGTGATGACCAG
CTTTCAAACCTGGATGCTGTAACACCCAACCGGTTCGACAATCAGTACTACAAAAACTTGCAGAAAAACAAGGGACTGCTGACGTCTGACCAGGAATTGTTCTCCGGCACCGGCTCGGAC
GCAGCGACACTGGTGAGCTCGTACGCCAGTAACCCGCTCACATTCTGGCGGGATTTCAAGGAGTCGATGATAAAAATGGGAAACATCAGCCCTCTCACAGGCACAAACGGAGAGATCCGT
AAGAACTGCCACTTTGTGAACAGTTGA

Retrieve as FASTA