Entry information : SmPrx77-1_52 (SmPrx77a_52)
Entry ID 7065
Creation 2009-10-19 (Paula Nunes)
Last sequence changes 2009-10-19 (Paula Nunes)
Sequence status complete
Reviewer Toky Ramarohetra
Last annotation changes 2011-02-01 (Toky Ramarohetra)
Peroxidase information: SmPrx77-1_52 (SmPrx77a_52)
Name (synonym) SmPrx77-1_52 (SmPrx77a_52)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx77-1_52
start..stop
S start..stop
SmPrx77-2_155 667 0 1..330 1..330
GbPrx53 390 5.4e-137 26..327 30..330
PtaPrx97 373 3.35e-130 30..327 30..326
PabPrx206 372 1.72e-129 31..327 39..334
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7065' 'join(1123042..1123272,1123348..1123536,1123620..1123785,1123851..1124257)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1123042..1123272 229 N° 2 1123348..1123536 187 N° 3 1123620..1123785 164 N° 4 1123851..1124257 405
join(1123042..1123272,1123348..1123536,1123620..1123785,1123851..1124257)


exon

Literature and cross-references SmPrx77-1_52 (SmPrx77a_52)
DNA ref. Phytozome 12:   scaffold_52 (1123042..1124254)
mRNA ref. JGI transcript:   138552 [Incorrect prediction]  179387 [Incorrect prediction]
Protein sequence: SmPrx77-1_52 (SmPrx77a_52)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (311)
PWM (Da):   %s   35828.93 (33869.8)  
PI (pH):   %s   4.83 (4.83) Peptide Signal:   %s   cut: 20 range:20-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLAILLMLSLLGSLSFANAQESSSGGDGGSGLKHKFYALSCPQAE
DIARRTLQRNRMSDPTAPAALLRVVFHDCQVE
GCDASILLETSSAMTAETVSEKNFSIRRLDYIHDIKAAIEKECPGIVSCADIIVMAARDAIAMSGGPQIPIETGRRDTLFASNLNADEALPPPTLTVSEMLDTLAEKGLDIEESVAILGA
HTLGVGHCLNFINRFDPQDNGPQMSPFFSTALRVLCQSPPSMSNATFAPNDLTNFMFDNQYFRDLQGQRGLLTVDAELPIDPRTKKHVDLFALNQLLFFAKFSDAFVKLTSFNVLTGSDG
EIRRDCRAVNREP

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No ESTs. Incorrect protein sequence prediction (short 5' is missing). Same sequence in scaffold 52 and 252.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGCGATTTTGCTGATGTTGTCGCTCCTGGGAAGCTTAAGCTTTGCCAATGCTCAGGAATCATCAAGCGGCGGCGATGGTGGCAGTGGGCTCAAGCACAAATTCTACGCGCTCTCG
TGCCCCCAGGCAGAGGATATTGCTCGAAGAACGCTCCAACGAAACAGGATGAGCGATCCCACCGCCCCTGCGGCGCTCCTCCGCGTCGTCTTCCATGATTGCCAGGTTGAG
AGGTACGTG
ATTGCGGTGATCGTGACGATTCTTGAGAGGAAATGAGGGAAAAGAAAGCTCTCGACTTGCTTTTGCAGGGATGCGATGCTTCGATTCTACTCGAGACATCTTCCGCGATGACCGCCGAGA
CCGTGTCGGAGAAGAATTTCTCCATTCGCCGCTTGGATTACATTCACGACATCAAGGCCGCCATTGAAAAGGAATGCCCCGGCATCGTCTCTTGCGCCGACATCATCGTTATGGCTGCCA
GGGACGCCATCGCAATG
TGGTGTGGGGATCTTTTCTTGTTCGATCGATCGATCGATCAGCTTGAGTTGAGGAACTTCTAACACTTTGCTCTTGATCTTGCAGTCTGGTGGTCCACAAATC
CCGATCGAAACTGGGCGAAGAGACACTCTCTTCGCCAGTAACTTAAACGCGGACGAAGCGCTGCCCCCTCCAACATTGACCGTGAGTGAGATGCTCGACACTCTCGCGGAAAAAGGCCTT
GACATCGAAGAGAGCGTCGCCATCTTAG
AGGTAAGAAAACCATCCCAATCCCATGTCCGCATCGATCGATCATGGATTGGTCGATTTCTTGGCAGGAGCTCACACATTGGGCGTTGGGCA
CTGCCTGAATTTCATCAATCGCTTCGATCCCCAGGACAATGGCCCCCAGATGTCGCCCTTCTTCTCCACGGCGCTCAGGGTCTTGTGCCAATCACCCCCTTCGATGAGCAATGCCACATT
CGCGCCCAACGATCTCACCAATTTCATGTTTGACAACCAGTACTTCCGCGATCTGCAAGGCCAGCGCGGATTGCTCACCGTGGACGCGGAGCTCCCCATCGATCCACGCACCAAGAAGCA
TGTCGATCTCTTCGCGCTCAATCAGCTCCTCTTCTTCGCCAAATTCAGCGACGCCTTCGTCAAGCTCACCAGCTTCAATGTGCTCACGGGCAGCGATGGTGAGATTCGGAGGGATTGCCG
GGCTGTGAATCGAGAGCCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGCGATTTTGCTGATGTTGTCGCTCCTGGGAAGCTTAAGCTTTGCCAATGCTCAGGAATCATCAAGCGGCGGCGATGGTGGCAGTGGGCTCAAGCACAAATTCTACGCGCTCTCG
TGCCCCCAGGCAGAGGATATTGCTCGAAGAACGCTCCAACGAAACAGGATGAGCGATCCCACCGCCCCTGCGGCGCTCCTCCGCGTCGTCTTCCATGATTGCCAGGTTGAG
GGATGCGAT
GCTTCGATTCTACTCGAGACATCTTCCGCGATGACCGCCGAGACCGTGTCGGAGAAGAATTTCTCCATTCGCCGCTTGGATTACATTCACGACATCAAGGCCGCCATTGAAAAGGAATGC
CCCGGCATCGTCTCTTGCGCCGACATCATCGTTATGGCTGCCAGGGACGCCATCGCAATG
TCTGGTGGTCCACAAATCCCGATCGAAACTGGGCGAAGAGACACTCTCTTCGCCAGTAAC
TTAAACGCGGACGAAGCGCTGCCCCCTCCAACATTGACCGTGAGTGAGATGCTCGACACTCTCGCGGAAAAAGGCCTTGACATCGAAGAGAGCGTCGCCATCTTAG
GAGCTCACACATTG
GGCGTTGGGCACTGCCTGAATTTCATCAATCGCTTCGATCCCCAGGACAATGGCCCCCAGATGTCGCCCTTCTTCTCCACGGCGCTCAGGGTCTTGTGCCAATCACCCCCTTCGATGAGC
AATGCCACATTCGCGCCCAACGATCTCACCAATTTCATGTTTGACAACCAGTACTTCCGCGATCTGCAAGGCCAGCGCGGATTGCTCACCGTGGACGCGGAGCTCCCCATCGATCCACGC
ACCAAGAAGCATGTCGATCTCTTCGCGCTCAATCAGCTCCTCTTCTTCGCCAAATTCAGCGACGCCTTCGTCAAGCTCACCAGCTTCAATGTGCTCACGGGCAGCGATGGTGAGATTCGG
AGGGATTGCCGGGCTGTGAATCGAGAGCCCTAG

Retrieve as FASTA