Entry information : SmPrx19-2_30 (SmPrx19b_30)
Entry ID 7071
Creation 2009-10-19 (Paula Nunes)
Last sequence changes 2009-10-19 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx19-2_30 (SmPrx19b_30)
Name (synonym) SmPrx19-2_30 (SmPrx19b_30)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx19-2_30
start..stop
S start..stop
SmPrx19-1_79 647 0 1..324 1..324
PpaPrx47 340 3.55e-117 27..324 27..326
PtaPrx03 333 1.32e-114 5..324 6..335
PabPrx36 327 4.39e-112 6..324 7..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7071' 'complement(join(553216..553613,553691..553853,553917..554105,554157..554381))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 554157..554381 223 N° 2 553917..554105 187 N° 3 553691..553853 161 N° 4 553216..553613 396
complement(join(553216..553613,553691..553853,553917..554105,554157..554381))


exon

Literature and cross-references SmPrx19-2_30 (SmPrx19b_30)
DNA ref. Phytozome 12:   scaffold_30 (554381..553216)
mRNA ref. JGI transcript:   416327
Protein sequence: SmPrx19-2_30 (SmPrx19b_30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (299)
PWM (Da):   %s   35092.05 (32516.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.78 (8.78) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSRGNSVLAMVFLLLFAGNVEVIGQSSGLRVGFYSRSCRNVEPI
VRGVVQRFLGRDRTVTAALLRLFFHDCFVR
GCDASLLLNSTRTNRSEKEHGANGSVRGYDLIDAAKAEVERQCRGVVSCADIVALATRDSIALAGGPDYPVPTGRRDGRISIVNDANVLPDPNSNANGAIQAFANKGLTPQDLVLLLGAH
TVGITHCGFFRHRLFNFRGTGRADPSMDPALVRQLQRACTSDSVEVFLDQGTPFRVDKVFFDQLVSNRAILIIDQQLRVEQRTDDIVRALANGTLNFNAAFAQSMTNMGNLDVLTGTRGE
IRRVCSAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGTAGAGGAAACTCTGTTCTTGCTATGGTTTTTCTTCTTTTGTTTGCCGGGAATGTGGAGGTCATTGGCCAGAGCAGTGGATTGCGAGTGGGATTCTACTCGAGATCGTGCCGC
AATGTAGAACCCATTGTTAGAGGCGTGGTGCAGAGGTTTCTCGGTAGGGATAGGACGGTCACGGCGGCACTGCTGCGGCTCTTCTTCCACGATTGCTTCGTCCGA
GTAAGTTTCCTGGCG
ATGGATAGTATCTGATACTTCATTTCCTCTTGGCAGGGGGATGCGATGCTTCTTTGTTGCTCAACTCCACGAGAACCAACCGATCCGAGAAGGAGCACGGAGCAAACGGGAGCGTCCGGG
GGTATGATCTTATCGACGCCGCCAAGGCCGAGGTGGAGAGGCAATGCCGGGGGGTTGTCTCGTGTGCCGATATCGTGGCATTGGCGACGAGAGATTCGATCGCCCTG
GTGAGTCTAGAGG
CGTTCCTTGGATTGATTGAACACCATGGTGGTTTTGTTTCGATCGAGCAGGCGCTGGAGGTCCAGACTACCCCGTTCCAACCGGGCGGAGGGACGGGAGAATCTCCATCGTGAACGACGC
AAACGTCTTGCCGGATCCAAACAGCAATGCCAACGGTGCCATCCAAGCCTTCGCAAACAAGGGCCTCACTCCGCAAGACCTTGTTCTCCTCCTGG
GTATGTACGGAAAGAACTTTGGGAC
TCCTCCGTGAACCCCGGAAAAATGATCATTTTCTTGTTGTCAATGAATGTAGGCGCGCTCACACTGTCGGAATCACGCACTGCGGCTTCTTTCGCCACCGCCTCTTCAACTTCCGCGGCA
CCGGGCGAGCGGACCCGAGCATGGATCCGGCGCTGGTGAGGCAGCTCCAGCGCGCTTGCACCTCAGACTCGGTGGAAGTTTTCCTCGACCAAGGAACTCCATTCCGTGTAGACAAGGTCT
TCTTCGATCAGCTCGTCTCCAACCGGGCGATCCTCATCATCGACCAGCAGCTCCGGGTGGAGCAAAGAACAGACGACATCGTCCGCGCGCTTGCAAACGGCACTCTCAACTTCAACGCCG
CGTTCGCGCAGTCCATGACCAATATGGGCAACTTGGATGTGCTCACGGGCACGCGCGGCGAGATTCGAAGAGTCTGCAGCGCTGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGTAGAGGAAACTCTGTTCTTGCTATGGTTTTTCTTCTTTTGTTTGCCGGGAATGTGGAGGTCATTGGCCAGAGCAGTGGATTGCGAGTGGGATTCTACTCGAGATCGTGCCGC
AATGTAGAACCCATTGTTAGAGGCGTGGTGCAGAGGTTTCTCGGTAGGGATAGGACGGTCACGGCGGCACTGCTGCGGCTCTTCTTCCACGATTGCTTCGTCCGA
GGATGCGATGCTTCT
TTGTTGCTCAACTCCACGAGAACCAACCGATCCGAGAAGGAGCACGGAGCAAACGGGAGCGTCCGGGGGTATGATCTTATCGACGCCGCCAAGGCCGAGGTGGAGAGGCAATGCCGGGGG
GTTGTCTCGTGTGCCGATATCGTGGCATTGGCGACGAGAGATTCGATCGCCCTG
GCTGGAGGTCCAGACTACCCCGTTCCAACCGGGCGGAGGGACGGGAGAATCTCCATCGTGAACGAC
GCAAACGTCTTGCCGGATCCAAACAGCAATGCCAACGGTGCCATCCAAGCCTTCGCAAACAAGGGCCTCACTCCGCAAGACCTTGTTCTCCTCCTGG
GCGCTCACACTGTCGGAATCACG
CACTGCGGCTTCTTTCGCCACCGCCTCTTCAACTTCCGCGGCACCGGGCGAGCGGACCCGAGCATGGATCCGGCGCTGGTGAGGCAGCTCCAGCGCGCTTGCACCTCAGACTCGGTGGAA
GTTTTCCTCGACCAAGGAACTCCATTCCGTGTAGACAAGGTCTTCTTCGATCAGCTCGTCTCCAACCGGGCGATCCTCATCATCGACCAGCAGCTCCGGGTGGAGCAAAGAACAGACGAC
ATCGTCCGCGCGCTTGCAAACGGCACTCTCAACTTCAACGCCGCGTTCGCGCAGTCCATGACCAATATGGGCAACTTGGATGTGCTCACGGGCACGCGCGGCGAGATTCGAAGAGTCTGC
AGCGCTGTGAACTAA

Retrieve as FASTA