Entry information : SmPrx38-1_2 (SmPrx38a_2)
Entry ID 7074
Creation 2009-10-19 (Paula Nunes)
Last sequence changes 2009-10-19 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx38-1_2 (SmPrx38a_2)
Name (synonym) SmPrx38-1_2 (SmPrx38a_2)
Class Class III peroxidase    [Orthogroup: Prx085]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx38-1_2
start..stop
S start..stop
SmPrx38-2_97 674 0 1..333 1..333
GbPrx69 384 1.46e-134 3..324 7..323
PabPrx173 379 1.7e-132 3..327 7..326
PtaPrx100 374 2.92e-130 3..326 7..325
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7074' 'complement(join(1587269..1587708,1587772..1587937,1588150..1588341,1588415..1588618))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1588415..1588618 202 N° 2 1588150..1588341 190 N° 3 1587772..1587937 164 N° 4 1587269..1587708 438
complement(join(1587269..1587708,1587772..1587937,1588150..1588341,1588415..1588 618))


exon

Literature and cross-references SmPrx38-1_2 (SmPrx38a_2)
DNA ref. Phytozome 12:   scaffold_2 (1588618..1587269)
mRNA ref. JGI transcript:   79034
Protein sequence: SmPrx38-1_2 (SmPrx38a_2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (312)
PWM (Da):   %s   35423.4 (33232.2)  
PI (pH):   %s   4.71 (4.62) Peptide Signal:   %s   cut: 22 range:22-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRCSLLLLFLSLLSLSGLGSSQLSVDFYNRTCPDVDKLVHSAVSA
MANQSNVVTPSTLRLLAHDCFVE
GCDASILITSTTNNTAERDATENNIPQQAFDTIIQAKKAVEAACPGVVSCADIVVMAARDAVVLAGGPHWEVTKGRRDGLISQASRVPGRLPGADFNVSELIENFAAVNLTADDMVILSG
AHTLGFSHCNQFRSRLYSFDGVNGSSDPSVNASYIGSLKVSCPPGETGPGKFTPFDVSSPFVFDNSYYKNLQIGRGLLFADQVLFTDNTTRPLVNEMADSQDDFFAAFVQAMTKMSNISV
KTGSDGEIRQSCSSFNAPPNSTTPT

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). no ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCTGCTCGCTCCTCCTCCTCTTCCTTTCCCTGCTCTCCCTTTCGGGTCTCGGATCGTCGCAGCTCTCGGTGGATTTCTACAACAGGACCTGCCCCGATGTAGACAAGCTCGTTCAC
AGCGCGGTCAGCGCGATGGCCAATCAGTCCAACGTAGTCACGCCGTCAACACTCCGGCTGCTTGCTCACGATTGCTTCGTAGAG
GTGAGTCGAGTCCCCCGAGCTCTCGAAAACTCTGGA
CGTTTACTCTACTTCTTCCTTGGTTCTTCTTCCTCAGGGGGGTGTGACGCATCAATTCTCATAACTTCGACCACCAACAACACCGCCGAGAGGGACGCGACCGAGAACAACATCCCGCAG
CAAGCCTTCGACACCATAATTCAGGCCAAGAAAGCCGTGGAGGCTGCCTGCCCGGGCGTGGTCTCCTGTGCCGACATAGTCGTCATGGCTGCGCGAGACGCCGTAGTACTG
GTAACTCCC
ACCACCTTGCTATGACTCCCTGCTTTTGTTCTTAGGATTCCCTGTTCCATAGCCTGTGGACTTGGTCGTAGTTGCCATAAACTTGCTGATTTGTTACTGAATTCCGACCATTCTCTGTAA
GTTGCTGGCTCAGATTTACCGCTGCTGATTTTCTGCATCGTGATTCTCCGCTTTCTTACTCCTCTAACTCCGTCCTGTTCAAGGCGCTGGAGGCCCGCACTGGGAAGTCACCAAAGGCCG
AAGGGATGGACTGATATCCCAAGCTTCCAGAGTTCCTGGCAGATTACCTGGAGCAGACTTCAACGTTAGCGAGCTAATAGAAAACTTTGCTGCTGTCAACCTCACCGCTGACGACATGGT
GATCCTCTCAG
GTGCAAATCCTTCGAATAGATCGAGCCATCCGTTTGACAGACAGTGACTTTGTTTCTTCGCAGGAGAGCGCATACTCTTGGATTTTCTCACTGCAACCAGTTCCGGAGC
AGGCTTTACAGTTTTGATGGAGTAAACGGCAGCAGCGACCCGAGCGTGAACGCGTCTTACATTGGATCGCTCAAAGTGAGCTGTCCACCCGGCGAAACTGGACCTGGAAAATTCACCCCG
TTCGATGTCAGCTCCCCCTTCGTCTTTGACAACTCTTACTACAAGAACTTGCAGATTGGAAGAGGCCTCCTGTTTGCGGACCAAGTGCTGTTCACCGATAACACCACCAGGCCGCTGGTG
AACGAGATGGCTGATTCCCAGGACGACTTCTTCGCGGCGTTTGTACAGGCGATGACCAAGATGAGCAACATAAGCGTCAAGACTGGAAGCGACGGGGAAATAAGGCAGAGCTGCAGCAGC
TTCAACGCCCCACCGAATTCAACCACACCAACTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCTGCTCGCTCCTCCTCCTCTTCCTTTCCCTGCTCTCCCTTTCGGGTCTCGGATCGTCGCAGCTCTCGGTGGATTTCTACAACAGGACCTGCCCCGATGTAGACAAGCTCGTTCAC
AGCGCGGTCAGCGCGATGGCCAATCAGTCCAACGTAGTCACGCCGTCAACACTCCGGCTGCTTGCTCACGATTGCTTCGTAGAG
GGGTGTGACGCATCAATTCTCATAACTTCGACCACC
AACAACACCGCCGAGAGGGACGCGACCGAGAACAACATCCCGCAGCAAGCCTTCGACACCATAATTCAGGCCAAGAAAGCCGTGGAGGCTGCCTGCCCGGGCGTGGTCTCCTGTGCCGAC
ATAGTCGTCATGGCTGCGCGAGACGCCGTAGTACTG
GCTGGAGGCCCGCACTGGGAAGTCACCAAAGGCCGAAGGGATGGACTGATATCCCAAGCTTCCAGAGTTCCTGGCAGATTACCT
GGAGCAGACTTCAACGTTAGCGAGCTAATAGAAAACTTTGCTGCTGTCAACCTCACCGCTGACGACATGGTGATCCTCTCAG
GAGCGCATACTCTTGGATTTTCTCACTGCAACCAGTTC
CGGAGCAGGCTTTACAGTTTTGATGGAGTAAACGGCAGCAGCGACCCGAGCGTGAACGCGTCTTACATTGGATCGCTCAAAGTGAGCTGTCCACCCGGCGAAACTGGACCTGGAAAATTC
ACCCCGTTCGATGTCAGCTCCCCCTTCGTCTTTGACAACTCTTACTACAAGAACTTGCAGATTGGAAGAGGCCTCCTGTTTGCGGACCAAGTGCTGTTCACCGATAACACCACCAGGCCG
CTGGTGAACGAGATGGCTGATTCCCAGGACGACTTCTTCGCGGCGTTTGTACAGGCGATGACCAAGATGAGCAACATAAGCGTCAAGACTGGAAGCGACGGGGAAATAAGGCAGAGCTGC
AGCAGCTTCAACGCCCCACCGAATTCAACCACACCAACTTGA

Retrieve as FASTA