Entry information : SmPrx38-2_97 (SmPrx38b_97)
Entry ID 7075
Creation 2009-10-19 (Paula Nunes)
Last sequence changes 2009-10-19 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx38-2_97 (SmPrx38b_97)
Name (synonym) SmPrx38-2_97 (SmPrx38b_97)
Class Class III peroxidase    [Orthogroup: Prx138]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx38-2_97
start..stop
S start..stop
SmPrx38-1_2 674 0 1..333 1..333
GbPrx69 382 6e-134 3..324 7..323
SmPrx81-2_146 375 6e-131 7..329 13..335
SmPrx81-1_124 375 1e-130 7..329 13..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 648205..648408 204 N° 2 647943..648134 192 N° 3 647554..647719 166 N° 4 647051..647490 440
complement(join(647051..647490,647554..647719,647943..648134,648205..648408))


exon

Literature and cross-references SmPrx38-2_97 (SmPrx38b_97)
DNA ref. Phytozome 12:   scaffold_97 (648408..647051)
mRNA ref. JGI transcript:   129813
EST ref. GenBank:   FE489646.1 [Fragment]
Protein sequence: SmPrx38-2_97 (SmPrx38b_97)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (312)
PWM (Da):   %s   35494.4 (33259.2)  
PI (pH):   %s   4.64 (4.62) Peptide Signal:   %s   cut: 22 range:22-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRCSLLLLFVSLLSLSDLGSSQLSVDFYNRTCPDVDKLVHNAVSAMANQSNVVTPSTLRLLAHDCFVEGCDASILITSTTNNTAERDATENNIPQQAFDTIIQAKKAVEVACPGVVSCADIVVMAARDAVVLAGGPHWEVTKGRRDGLISQASRVPGRLPGADFNVSELIENFAAVNLTADDMVILSGAHTLGFSHCNQFRSRLYSFDGVNGSSDPSVNASYIGSLKASCPPGETGPGKFTPFDVSSPFVFDNSYYKNLQIGRGLLFADQVLFTDNTTRPLVNEMADSQDDFFAAFVQAMTKMSNISVKTGSDGEIRQSCSSFNAPPNSTTPT

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 1 EST (DNA contamination!!!).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCTGCTCGCTCCTCCTCCTCTTCGTTTCCCTGCTCTCCCTTTCGGATCTCGGATCGTCGCAGCTCTCGGTGGATTTCTACAACAGGACCTGCCCCGATGTAGACAAGCTCGTTCAC
AACGCGGTCAGCGCGATGGCCAATCAGTCCAACGTAGTCACGCCGTCAACACTCCGGCTGCTTGCTCACGATTGCTTCGTAGAG
GTGAGTCGAGTCCCCCGAGCTCTCGAAAATGGACGT
TTACTCTGCTTCTTCCTTGGTTCTTCTTCCTCAGGGGTGTGACGCATCAATTCTCATAACTTCGACCACCAACAACACCGCCGAGAGGGACGCGACCGAGAACAACATCCCGCAGCAAGC
CTTTGACACCATAATTCAGGCCAAGAAAGCCGTGGAGGTTGCCTGCCCGGGCGTGGTCTCCTGTGCCGACATAGTCGTCATGGCTGCGCGAGACGCCGTAGTACTG
GTAACTCCCACCAC
CTTGCTATGACTCCCTGCTTTTGTTTTTAGGATTCCCTGTTCCATAGCCTGCGGACTTGGTCGTAGTTGCCATAAACTTGCTGATTTGTTACTGAATTCCGACCATTCTCTGTAAGTTGC
TGGCTCAGATTTACCGCTGCTGATTTTCTGCATCGTGATTCTCCTCCGGGAAAGAGCTTTCTTACTCCTCTAACTTCGTCCTGTTCAAGGCTGGAGGCCCGCACTGGGAAGTCACCAAAG
GCCGAAGAGATGGACTGATATCCCAAGCTTCCAGAGTTCCTGGCAGATTACCTGGAGCAGACTTCAACGTTAGCGAGCTAATAGAAAACTTTGCTGCTGTCAACCTCACCGCTGACGACA
TGGTGATCCTCTCAG
GTGCAAATCCTTCGAATAGCTCGACCAATCCTTTTGACAGACAGTGACTTTGTTTCTTCGCAGGAGCGCATACTCTTGGATTTTCTCACTGCAACCAGTTCCGGA
GCAGGCTTTACAGTTTTGATGGAGTAAACGGCAGCAGCGACCCGAGCGTGAACGCGTCTTACATTGGATCGCTCAAAGCGAGCTGTCCACCCGGCGAAACTGGACCTGGAAAATTCACCC
CGTTCGATGTCAGCTCCCCCTTCGTCTTTGACAACTCTTACTACAAGAACTTGCAGATTGGAAGAGGCCTCCTGTTTGCGGACCAAGTGCTGTTCACCGATAACACCACCAGGCCGCTGG
TGAACGAGATGGCTGATTCCCAGGACGACTTCTTCGCGGCGTTTGTACAGGCGATGACCAAGATGAGCAACATAAGCGTCAAGACTGGAAGCGACGGGGAAATAAGGCAGAGCTGCAGCA
GCTTCAACGCCCCACCGAATTCAACCACACCAACTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCTGCTCGCTCCTCCTCCTCTTCGTTTCCCTGCTCTCCCTTTCGGATCTCGGATCGTCGCAGCTCTCGGTGGATTTCTACAACAGGACCTGCCCCGATGTAGACAAGCTCGTTCAC
AACGCGGTCAGCGCGATGGCCAATCAGTCCAACGTAGTCACGCCGTCAACACTCCGGCTGCTTGCTCACGATTGCTTCGTAGAG
GGGTGTGACGCATCAATTCTCATAACTTCGACCACC
AACAACACCGCCGAGAGGGACGCGACCGAGAACAACATCCCGCAGCAAGCCTTTGACACCATAATTCAGGCCAAGAAAGCCGTGGAGGTTGCCTGCCCGGGCGTGGTCTCCTGTGCCGAC
ATAGTCGTCATGGCTGCGCGAGACGCCGTAGTACTG
GCTGGAGGCCCGCACTGGGAAGTCACCAAAGGCCGAAGAGATGGACTGATATCCCAAGCTTCCAGAGTTCCTGGCAGATTACCT
GGAGCAGACTTCAACGTTAGCGAGCTAATAGAAAACTTTGCTGCTGTCAACCTCACCGCTGACGACATGGTGATCCTCTCAG
GAGCGCATACTCTTGGATTTTCTCACTGCAACCAGTTC
CGGAGCAGGCTTTACAGTTTTGATGGAGTAAACGGCAGCAGCGACCCGAGCGTGAACGCGTCTTACATTGGATCGCTCAAAGCGAGCTGTCCACCCGGCGAAACTGGACCTGGAAAATTC
ACCCCGTTCGATGTCAGCTCCCCCTTCGTCTTTGACAACTCTTACTACAAGAACTTGCAGATTGGAAGAGGCCTCCTGTTTGCGGACCAAGTGCTGTTCACCGATAACACCACCAGGCCG
CTGGTGAACGAGATGGCTGATTCCCAGGACGACTTCTTCGCGGCGTTTGTACAGGCGATGACCAAGATGAGCAACATAAGCGTCAAGACTGGAAGCGACGGGGAAATAAGGCAGAGCTGC
AGCAGCTTCAACGCCCCACCGAATTCAACCACACCAACTTGA

Retrieve as FASTA