Entry information : SmPrx78-2_12 (SmPrx78b_12)
Entry ID 7077
Creation 2009-10-22 (Paula Nunes)
Last sequence changes 2009-10-22 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx78-2_12 (SmPrx78b_12)
Name (synonym) SmPrx78-2_12 (SmPrx78b_12)
Class Class III peroxidase    [Orthogroup: Prx289]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx78-2_12
start..stop
S start..stop
SmPrx78-1_15 683 0 1..334 1..334
WmPrx08 350 5e-121 14..334 7..333
SmPrx36-2_44 350 4e-120 35..334 72..375
SmPrx36-1_2 349 4e-120 35..334 72..375
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1786630..1786878 249 N° 2 1786926..1787108 183 N° 3 1787162..1787327 166 N° 4 1787383..1787789 407
join(1786630..1786878,1786926..1787108,1787162..1787327,1787383..1787789)


exon

Literature and cross-references SmPrx78-2_12 (SmPrx78b_12)
DNA ref. Phytozome 12:   scaffold_12 (1786630..1787789)
mRNA ref. JGI transcript:   91394
Protein sequence: SmPrx78-2_12 (SmPrx78b_12)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (303)
PWM (Da):   %s   36045.2 (32774.6)  
PI (pH):   %s   8.32 (8.20) Peptide Signal:   %s   cut: 32 range:32-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSQCMRSGVESLSRSMVSWVGFSALLVLAASHEMSATLSPTFYDDSCPDLKWIVDSVLQAALLKDPRIGAKLLRMHFHDCFVQGCDASVLLDEAQGEKTAQPNLNSLMGFDVVDSIKSAVESACPGIVSCADILAVAAEVSVVLAGGPSWKVLLGRRDSLTGSKRLANRDIPPPTSTFSQLVKAFKKKGLSAEDMIVLSGGHTIGASRCASFTQRLYNQSGSFQADPTIEKRYLFNLQQVCPRNGDGNVTQSLDFSPRSFDNNYYKLVVSNLGLLNSDQVLTTQSQGSAALVSALSRDQTSFFNRFAVSMVKMGNISPLVGNKGEIRNKCRYRN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Incorrect prediction from JGI transcript (short PS).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCAGTGCATGCGCAGTGGAGTGGAGTCACTGAGCAGAAGTATGGTTTCTTGGGTTGGGTTTAGTGCACTTCTTGTGTTGGCTGCCTCCCATGAAATGAGTGCAACCTTGAGTCCT
ACATTTTACGATGATTCATGTCCGGATCTGAAATGGATAGTAGACAGTGTTCTCCAAGCTGCATTACTCAAAGATCCCAGAATTGGAGCCAAGCTTCTAAGAATGCATTTCCACGACTGT
TTTGTTCAG
GTAAGTCACCCAAAGTTTAGAGACGTTTTCTTACGACACTCAAACAGGGTTGTGATGCCTCCGTGCTGCTGGATGAAGCACAAGGAGAGAAAACTGCTCAGCCAAACTTGA
ACTCGTTGATGGGTTTTGATGTTGTAGATTCCATCAAGAGTGCAGTGGAAAGTGCGTGTCCAGGAATTGTTTCATGTGCCGATATCCTGGCAGTAGCAGCTGAAGTGTCCGTAGTGTTG
G
TACGTTAATACATTGACTTTTCATTTTCTTTGACGGGCGTGTGTGATGCTAGGCTGGAGGGCCATCTTGGAAGGTGTTGCTGGGAAGGCGAGACAGCTTGACCGGAAGCAAGAGGCTTGC
AAACAGGGACATTCCGCCGCCAACTTCCACCTTTTCCCAGCTGGTGAAGGCGTTCAAGAAGAAAGGCCTGTCGGCGGAGGACATGATCGTCCTTTCGG
GTCTGTTGTGGATTCGAAAAAT
GGAATTGTTACTGACCGTGTACGCTTGGAACAGGCGGGCACACGATTGGAGCATCCCGTTGCGCGAGTTTCACGCAGAGGCTGTATAACCAGAGCGGGAGTTTCCAGGCTGATCCAACAA
TCGAGAAGCGCTACCTGTTCAATCTACAGCAGGTGTGTCCCAGGAATGGAGACGGCAACGTGACACAGTCTCTTGACTTCAGCCCCCGGTCCTTCGACAACAACTACTACAAGCTTGTGG
TGTCGAATCTGGGGCTCCTCAACTCGGACCAAGTATTGACGACACAGTCTCAGGGTAGCGCCGCTCTTGTGAGTGCCTTGAGCAGGGACCAGACGAGCTTCTTCAATAGGTTTGCAGTGT
CCATGGTTAAGATGGGGAACATTTCCCCTCTGGTTGGCAACAAGGGGGAGATCCGGAATAAGTGCCGATACAGGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCAGTGCATGCGCAGTGGAGTGGAGTCACTGAGCAGAAGTATGGTTTCTTGGGTTGGGTTTAGTGCACTTCTTGTGTTGGCTGCCTCCCATGAAATGAGTGCAACCTTGAGTCCT
ACATTTTACGATGATTCATGTCCGGATCTGAAATGGATAGTAGACAGTGTTCTCCAAGCTGCATTACTCAAAGATCCCAGAATTGGAGCCAAGCTTCTAAGAATGCATTTCCACGACTGT
TTTGTTCAG
GGTTGTGATGCCTCCGTGCTGCTGGATGAAGCACAAGGAGAGAAAACTGCTCAGCCAAACTTGAACTCGTTGATGGGTTTTGATGTTGTAGATTCCATCAAGAGTGCAGTG
GAAAGTGCGTGTCCAGGAATTGTTTCATGTGCCGATATCCTGGCAGTAGCAGCTGAAGTGTCCGTAGTGTTG
GCTGGAGGGCCATCTTGGAAGGTGTTGCTGGGAAGGCGAGACAGCTTG
ACCGGAAGCAAGAGGCTTGCAAACAGGGACATTCCGCCGCCAACTTCCACCTTTTCCCAGCTGGTGAAGGCGTTCAAGAAGAAAGGCCTGTCGGCGGAGGACATGATCGTCCTTTCGG
GC
GGGCACACGATTGGAGCATCCCGTTGCGCGAGTTTCACGCAGAGGCTGTATAACCAGAGCGGGAGTTTCCAGGCTGATCCAACAATCGAGAAGCGCTACCTGTTCAATCTACAGCAGGTG
TGTCCCAGGAATGGAGACGGCAACGTGACACAGTCTCTTGACTTCAGCCCCCGGTCCTTCGACAACAACTACTACAAGCTTGTGGTGTCGAATCTGGGGCTCCTCAACTCGGACCAAGTA
TTGACGACACAGTCTCAGGGTAGCGCCGCTCTTGTGAGTGCCTTGAGCAGGGACCAGACGAGCTTCTTCAATAGGTTTGCAGTGTCCATGGTTAAGATGGGGAACATTTCCCCTCTGGTT
GGCAACAAGGGGGAGATCCGGAATAAGTGCCGATACAGGAACTAA

Retrieve as FASTA