Entry information : SmPrx81-1_124 (SmPrx81a_124)
Entry ID 7083
Creation 2009-10-21 (Paula Nunes)
Last sequence changes 2009-10-21 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx81-1_124 (SmPrx81a_124)
Name (synonym) SmPrx81-1_124 (SmPrx81a_124)
Class Class III peroxidase    [Orthogroup: Prx085]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressors Abscisic acid (ABA)
Cold stress
Glomus intraradices infection
Glomus mosseae infection
glucose-rich medium
Best BLASTp hits
Perox score E-value SmPrx81-1_124
start..stop
S start..stop
SmPrx81-2_146 675 0 1..335 1..335
PabPrx173 374 1.96e-130 17..330 8..323
SmPrx38-2_97 367 1.67e-127 32..335 26..329
PtaPrx100 365 5.1e-127 18..330 9..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7083' 'complement(join(83755..84179,84235..84400,84458..84652,84754..84975))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 84754..84975 220 N° 2 84458..84652 193 N° 3 84235..84400 164 N° 4 83755..84179 423
complement(join(83755..84179,84235..84400,84458..84652,84754..84975))


exon

Literature and cross-references SmPrx81-1_124 (SmPrx81a_124)
DNA ref. Phytozome 12:   scaffold_124 (84975..83755)
mRNA ref. JGI transcript:   269862
Protein sequence: SmPrx81-1_124 (SmPrx81a_124)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (308)
PWM (Da):   %s   35648.21 (32813.7) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.95 (7.98) Peptide Signal:   %s   cut: 28 range:28-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVHPIHANVVSWIVIVSLSCLLHGATGQLTFDFYKTACPNVDAIV
ANVTLALSKRDNVVPPAVLRLYFHDCLVE
GCDASILISSTPTNVAERDAADNLSFPQNGFDAIVEAKKAVEAACPAVVSCADILAMAARDVVVFSGGPRWAVPKGRRDGLISRAARVEGRLPASSFNVSQLITLLATVNLSIEDLVVLSGAHTIGFSHCNQFSKRLYNFSSAAKTDPSLDPTLAASLKASCPQVGGSPNTVRGFDATTPLAFDNSYYRNLQNNRGLLVSDQALALDKRTSPVVASLAASQEDFFFAFMQAMVKLGYTGI
KTGSQGEVRRDCRAFNARSNT

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCATCCCATCCATGCTAACGTTGTCTCTTGGATCGTCATTGTCTCATTGTCTTGTCTACTACATGGAGCAACTGGCCAGCTTACCTTCGACTTCTACAAGACCGCTTGTCCGAAT
GTGGATGCCATCGTCGCTAACGTCACTCTCGCCCTCTCCAAAAGGGACAATGTGGTTCCACCCGCGGTGTTGCGCCTCTACTTCCACGATTGCCTGGTGGAG
GTGAGTACGTGAGGCCGT
GTTGCGAATTATGGATGAATTCGATCCATCCACTGGCAGTGTAGCTTAGCTTGACATTGTATGATCTTGGTTGGCACTGGCAGGGGGCTGTGATGCATCCATTCTCATCTCCTCCACGCC
CACCAACGTCGCGGAGCGAGACGCGGCCGACAATTTGAGCTTCCCGCAGAATGGATTCGACGCAATTGTGGAGGCCAAGAAGGCAGTGGAGGCTGCATGCCCCGCGGTTGTCTCGTGCGC
CGACATCCTCGCAATGGCCGCCAGGGACGTGGTTGTGTTT
GTAAGTGACGATTGATGCTCTCTCTCACGATCCAAATATTTGCGCTTCATACGACAGAGAGTGGCGGCCCCAGGTGGGCG
GTCCCCAAAGGTCGGCGGGACGGCCTCATCTCTCGCGCTGCACGCGTCGAGGGCCGCCTCCCGGCCTCCAGTTTCAATGTGTCGCAACTTATCACCCTGCTGGCCACTGTCAACTTGAGC
ATCGAAGATCTGGTTGTACTGTCAG
GTGTGCATAGTATTACACAAGTAGCGACACTAGATAGTGATATAGTTCCTCGCAGGAGAGCACACACAATTGGATTCTCCCATTGCAACCAGTTC
TCCAAGAGGCTCTACAACTTCAGCAGCGCCGCAAAGACGGACCCGTCGCTGGATCCGACGCTAGCTGCGTCGCTCAAGGCTTCGTGCCCGCAAGTTGGCGGGAGCCCCAACACGGTGCGG
GGATTCGACGCCACCACGCCCTTAGCCTTTGACAACTCCTACTACCGCAACCTGCAAAACAACAGGGGCCTGCTCGTGTCGGATCAGGCGCTGGCCCTGGACAAGCGGACGTCGCCCGTG
GTGGCCAGCTTGGCCGCCAGCCAGGAAGACTTCTTCTTCGCCTTCATGCAAGCCATGGTGAAGCTGGGCTACACCGGCATCAAGACCGGCAGCCAGGGCGAGGTCCGCAGAGACTGTAGA
GCTTTCAATGCTCGATCAAACACCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCATCCCATCCATGCTAACGTTGTCTCTTGGATCGTCATTGTCTCATTGTCTTGTCTACTACATGGAGCAACTGGCCAGCTTACCTTCGACTTCTACAAGACCGCTTGTCCGAAT
GTGGATGCCATCGTCGCTAACGTCACTCTCGCCCTCTCCAAAAGGGACAATGTGGTTCCACCCGCGGTGTTGCGCCTCTACTTCCACGATTGCCTGGTGGAG
GGCTGTGATGCATCCATT
CTCATCTCCTCCACGCCCACCAACGTCGCGGAGCGAGACGCGGCCGACAATTTGAGCTTCCCGCAGAATGGATTCGACGCAATTGTGGAGGCCAAGAAGGCAGTGGAGGCTGCATGCCCC
GCGGTTGTCTCGTGCGCCGACATCCTCGCAATGGCCGCCAGGGACGTGGTTGTGTTT
AGTGGCGGCCCCAGGTGGGCGGTCCCCAAAGGTCGGCGGGACGGCCTCATCTCTCGCGCTGCA
CGCGTCGAGGGCCGCCTCCCGGCCTCCAGTTTCAATGTGTCGCAACTTATCACCCTGCTGGCCACTGTCAACTTGAGCATCGAAGATCTGGTTGTACTGTCAG
GAGCACACACAATTGGA
TTCTCCCATTGCAACCAGTTCTCCAAGAGGCTCTACAACTTCAGCAGCGCCGCAAAGACGGACCCGTCGCTGGATCCGACGCTAGCTGCGTCGCTCAAGGCTTCGTGCCCGCAAGTTGGC
GGGAGCCCCAACACGGTGCGGGGATTCGACGCCACCACGCCCTTAGCCTTTGACAACTCCTACTACCGCAACCTGCAAAACAACAGGGGCCTGCTCGTGTCGGATCAGGCGCTGGCCCTG
GACAAGCGGACGTCGCCCGTGGTGGCCAGCTTGGCCGCCAGCCAGGAAGACTTCTTCTTCGCCTTCATGCAAGCCATGGTGAAGCTGGGCTACACCGGCATCAAGACCGGCAGCCAGGGC
GAGGTCCGCAGAGACTGTAGAGCTTTCAATGCTCGATCAAACACCTAG

Retrieve as FASTA