Entry information : SmPrx82-1_124 (SmPrx82a_124)
Entry ID 7084
Creation 2009-10-21 (Paula Nunes)
Last sequence changes 2009-10-21 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx82-1_124 (SmPrx82a_124)
Name (synonym) SmPrx82-1_124 (SmPrx82a_124)
Class Class III peroxidase    [Orthogroup: Prx291]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx82-1_124
start..stop
S start..stop
SmPrx82-2_146 657 0 1..323 1..323
PabPrx159 330 2e-113 12..323 25..339
PabPrx74 330 4e-113 12..323 19..333
PabPrx212 325 3e-111 12..323 25..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 296017..296223 207 N° 2 295762..295953 192 N° 3 295533..295698 166 N° 4 295061..295467 407
complement(join(295061..295467,295533..295698,295762..295953,296017..296223))


exon

Literature and cross-references SmPrx82-1_124 (SmPrx82a_124)
DNA ref. Phytozome 12:   scaffold_124 (296223..295061)
mRNA ref. JGI transcript:   134234
Protein sequence: SmPrx82-1_124 (SmPrx82a_124)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   35550.3 (33062.9)  
PI (pH):   %s   9.29 (8.93) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGDYKVWRVLSLFLLVVIAARGDLSYDFYKTRCPQAEKIVMDVMVNATLSDRRIGASILRMHFHDCFVEGCDGSILIDSTPTNRAEKDFPANFPSIRGFDVIDAAKAAVEKVCPGIVSCADILAFAARDGVHLSHGPFWDIRSGRRDGRVSMFNRVPLFLPPPTSNITQLVTSFAAKNLSKSDLVFLSGGHTIGFSLCSSFNSRLYNFTGRGDQDPALDASLAQTLKGQCPRPPTRVDPIVPMEKTPFKVDTKYFKGVLKRRGLFTSDSALLNDPFTKSLVIKSAADESFFLGNFIQSMIKMSELEVKTGSKGEIRKKCHVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGATTATAAGGTTTGGAGAGTTTTGAGCCTGTTCTTGCTTGTTGTCATCGCTGCCCGAGGGGATCTCTCGTATGACTTCTACAAAACGAGATGTCCACAGGCAGAGAAGATTGTC
ATGGATGTCATGGTGAATGCCACATTGTCTGACAGGCGAATTGGTGCGTCCATCTTGCGTATGCATTTCCACGACTGCTTTGTCGAA
GTAAGTTTTGATAAACCTTTGGCTCATAAAAAC
TTAGCATTTGTCAACTCTTTGATTGATCAGGGCTGTGATGGATCCATCCTCATCGATTCCACCCCCACAAACCGGGCCGAGAAGGATTTCCCAGCAAACTTCCCCAGCATTCGCGGCTTT
GATGTGATTGACGCTGCCAAGGCAGCCGTGGAGAAAGTCTGTCCGGGGATCGTGTCTTGTGCTGACATTCTAGCCTTCGCTGCGCGAGATGGTGTTCATCTG
GTATCTTATCTATCATTC
CTAATCATCTTATCGCGAAACTAATCAATCTCTTCTGGTATTCAGTCGCACGGACCATTCTGGGACATCCGGTCGGGACGTCGAGACGGCCGAGTTTCCATGTTTAATCGCGTCCCTCTC
TTCCTTCCACCACCCACATCCAACATCACGCAGCTCGTCACCAGCTTCGCAGCCAAGAACTTAAGCAAGAGTGATCTTGTCTTCCTCTCAG
GTACAGTCTCTGCAAGAATCTCTATAGAT
GTGCAAATCTTACGATGGGGTCATTGAATTATCTAGGTGGTCACACGATTGGATTCTCTCTTTGCTCCTCCTTCAACAGCCGGCTCTACAATTTCACCGGGAGAGGCGACCAGGACCCAG
CGCTCGATGCGTCTCTCGCCCAGACTCTCAAAGGGCAGTGCCCTCGTCCTCCAACCAGGGTCGATCCAATCGTCCCAATGGAGAAGACCCCATTCAAAGTAGACACGAAATACTTCAAGG
GAGTGCTCAAGAGGCGCGGCCTCTTCACCTCCGACTCCGCCCTTCTCAATGATCCATTCACGAAGTCTCTGGTGATCAAGAGCGCCGCGGACGAGTCATTCTTCCTTGGGAATTTCATCC
AGTCCATGATCAAGATGAGCGAATTGGAGGTCAAGACTGGATCGAAAGGCGAGATCCGGAAGAAGTGTCACGTCATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGATTATAAGGTTTGGAGAGTTTTGAGCCTGTTCTTGCTTGTTGTCATCGCTGCCCGAGGGGATCTCTCGTATGACTTCTACAAAACGAGATGTCCACAGGCAGAGAAGATTGTC
ATGGATGTCATGGTGAATGCCACATTGTCTGACAGGCGAATTGGTGCGTCCATCTTGCGTATGCATTTCCACGACTGCTTTGTCGAA
GGCTGTGATGGATCCATCCTCATCGATTCCACC
CCCACAAACCGGGCCGAGAAGGATTTCCCAGCAAACTTCCCCAGCATTCGCGGCTTTGATGTGATTGACGCTGCCAAGGCAGCCGTGGAGAAAGTCTGTCCGGGGATCGTGTCTTGTGCT
GACATTCTAGCCTTCGCTGCGCGAGATGGTGTTCATCTG
TCGCACGGACCATTCTGGGACATCCGGTCGGGACGTCGAGACGGCCGAGTTTCCATGTTTAATCGCGTCCCTCTCTTCCTT
CCACCACCCACATCCAACATCACGCAGCTCGTCACCAGCTTCGCAGCCAAGAACTTAAGCAAGAGTGATCTTGTCTTCCTCTCAG
GTGGTCACACGATTGGATTCTCTCTTTGCTCCTCC
TTCAACAGCCGGCTCTACAATTTCACCGGGAGAGGCGACCAGGACCCAGCGCTCGATGCGTCTCTCGCCCAGACTCTCAAAGGGCAGTGCCCTCGTCCTCCAACCAGGGTCGATCCAATC
GTCCCAATGGAGAAGACCCCATTCAAAGTAGACACGAAATACTTCAAGGGAGTGCTCAAGAGGCGCGGCCTCTTCACCTCCGACTCCGCCCTTCTCAATGATCCATTCACGAAGTCTCTG
GTGATCAAGAGCGCCGCGGACGAGTCATTCTTCCTTGGGAATTTCATCCAGTCCATGATCAAGATGAGCGAATTGGAGGTCAAGACTGGATCGAAAGGCGAGATCCGGAAGAAGTGTCAC
GTCATCAACTGA

Retrieve as FASTA