Entry information : SmPrx81-2_146 (SmPrx81b_146)
Entry ID 7085
Creation 2009-10-22 (Christophe Dunand)
Last sequence changes 2009-10-22 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: SmPrx81-2_146 (SmPrx81b_146)
Name (synonym) SmPrx81-2_146 (SmPrx81b_146)
Class Class III peroxidase    [Orthogroup: Prx067]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx81-2_146
start..stop
S start..stop
SmPrx81-1_124 675 0 1..335 1..335
PtaPrx100 372 1e-129 18..330 9..323
PabPrx173 371 2e-129 17..330 8..323
SmPrx38-2_97 367 9e-128 32..335 26..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 89732..89953 222 N° 2 89436..89630 195 N° 3 89213..89378 166 N° 4 88733..89157 425
complement(join(88733..89157,89213..89378,89436..89630,89732..89953))


exon

Literature and cross-references SmPrx81-2_146 (SmPrx81b_146)
DNA ref. Phytozome 12:   scaffold_146 (89953..88733)
mRNA ref. JGI transcript:   236645
Protein sequence: SmPrx81-2_146 (SmPrx81b_146)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (308)
PWM (Da):   %s   35700.17 (32865.7) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.95 (7.98) Peptide Signal:   %s   cut: 28 range:28-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVHPIHANVVSWIVIVSLSCLLHGATGQLTFDFYKTSCPNVDAIVANVTLALSKRDNVVAPAVLRLYFHDCLVEGCDASILISSTPTNVAERDAPDNLSFPQNGFDAIVEAKKAVEAACPAVVSCADILAMAARDVVVFSGGPRWAVPKGRRDGLISRAARVEGRLPASSFNVSQLVTLLSTVNLSIEDLVVLSGAHTIGFSHCNQFSKRLYNFSSAAKTDPSLDPTLAASLKASCPQVGGSPNTVRGFDATTPFAFDNSYYRNLQNNRGLLVSDQALALDKRTSPVVASLAASQEDFFFAFMQAMVKLGYTGIKTGSQGEVRRDCRAFNARSNT

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCATCCCATCCATGCTAACGTTGTCTCTTGGATCGTCATTGTCTCATTGTCTTGTCTACTACATGGAGCAACTGGCCAGCTTACCTTCGACTTCTACAAGACCTCTTGTCCGAAT
GTGGATGCCATCGTCGCTAACGTCACTCTCGCCCTCTCCAAAAGGGACAATGTGGTTGCACCCGCGGTGTTGCGCCTCTACTTCCACGATTGCCTGGTGGAG
GTGAGTACGTGAGGCCGT
CTTGCGCATTATGGATGAATTCGATCCATCCACTGGCAGTGTAGCTTAGCTTGACATTGTATGATCTTGGTTGGCACTGGCAGGGCTGTGATGCATCCATTCTCATCTCCTCCACGCCCA
CCAACGTCGCGGAGCGAGACGCGCCCGACAATTTGAGCTTCCCGCAGAATGGATTCGACGCAATTGTGGAGGCCAAGAAGGCAGTGGAGGCTGCATGCCCCGCGGTTGTCTCGTGCGCCG
ACATCCTCGCAATGGCCGCCAGGGACGTGGTTGTGTTT
GTAAGTGACGATTGATGCTCTCTCTCACGATCCAAATATTTGCGCTTCATACGACAGAGTGGCGGCCCCAGGTGGGCGGTCC
CCAAAGGTCGGCGGGACGGCCTCATCTCTCGCGCTGCCCGCGTCGAGGGCCGCCTCCCGGCCTCCAGTTTCAATGTGTCGCAACTTGTCACCCTGCTGTCCACTGTCAACTTGAGCATCG
AAGATCTGGTTGTACTGTCAG
GTGTGCATAGTATTACACAAGTAGCGACACTAGATAGTGATATAGTTCCTCGCAGGAGCACACACAATTGGATTCTCCCATTGCAACCAGTTCTCCAAG
AGGCTCTACAACTTCAGCAGCGCCGCAAAGACGGACCCGTCGCTGGATCCGACGCTAGCTGCGTCGCTCAAGGCTTCGTGCCCGCAAGTTGGCGGGAGCCCCAACACGGTGCGGGGATTC
GACGCCACCACGCCCTTCGCCTTTGACAACTCCTACTACCGCAACCTGCAAAACAACAGGGGCCTGCTCGTGTCGGATCAGGCGCTGGCCCTGGACAAGCGGACGTCGCCCGTGGTGGCC
AGCTTGGCCGCCAGCCAGGAAGACTTCTTCTTCGCCTTCATGCAAGCCATGGTGAAGCTGGGCTACACCGGCATCAAGACCGGCAGCCAGGGCGAGGTCCGCAGAGACTGTAGAGCTTTC
AATGCTCGATCAAACACCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCATCCCATCCATGCTAACGTTGTCTCTTGGATCGTCATTGTCTCATTGTCTTGTCTACTACATGGAGCAACTGGCCAGCTTACCTTCGACTTCTACAAGACCTCTTGTCCGAAT
GTGGATGCCATCGTCGCTAACGTCACTCTCGCCCTCTCCAAAAGGGACAATGTGGTTGCACCCGCGGTGTTGCGCCTCTACTTCCACGATTGCCTGGTGGAG
GGCTGTGATGCATCCATT
CTCATCTCCTCCACGCCCACCAACGTCGCGGAGCGAGACGCGCCCGACAATTTGAGCTTCCCGCAGAATGGATTCGACGCAATTGTGGAGGCCAAGAAGGCAGTGGAGGCTGCATGCCCC
GCGGTTGTCTCGTGCGCCGACATCCTCGCAATGGCCGCCAGGGACGTGGTTGTGTTT
AGTGGCGGCCCCAGGTGGGCGGTCCCCAAAGGTCGGCGGGACGGCCTCATCTCTCGCGCTGCC
CGCGTCGAGGGCCGCCTCCCGGCCTCCAGTTTCAATGTGTCGCAACTTGTCACCCTGCTGTCCACTGTCAACTTGAGCATCGAAGATCTGGTTGTACTGTCAG
GAGCACACACAATTGGA
TTCTCCCATTGCAACCAGTTCTCCAAGAGGCTCTACAACTTCAGCAGCGCCGCAAAGACGGACCCGTCGCTGGATCCGACGCTAGCTGCGTCGCTCAAGGCTTCGTGCCCGCAAGTTGGC
GGGAGCCCCAACACGGTGCGGGGATTCGACGCCACCACGCCCTTCGCCTTTGACAACTCCTACTACCGCAACCTGCAAAACAACAGGGGCCTGCTCGTGTCGGATCAGGCGCTGGCCCTG
GACAAGCGGACGTCGCCCGTGGTGGCCAGCTTGGCCGCCAGCCAGGAAGACTTCTTCTTCGCCTTCATGCAAGCCATGGTGAAGCTGGGCTACACCGGCATCAAGACCGGCAGCCAGGGC
GAGGTCCGCAGAGACTGTAGAGCTTTCAATGCTCGATCAAACACCTAG

Retrieve as FASTA