Entry information : SmPrx82-2_146 (SmPrx82b_146)
Entry ID 7086
Creation 2009-10-21 (Paula Nunes)
Last sequence changes 2009-10-21 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx82-2_146 (SmPrx82b_146)
Name (synonym) SmPrx82-2_146 (SmPrx82b_146)
Class Class III peroxidase    [Orthogroup: Prx291]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx82-2_146
start..stop
S start..stop
SmPrx82-1_124 657 0 1..323 1..323
PabPrx159 328 2e-112 12..323 25..339
PabPrx74 327 4e-112 12..323 19..333
PabPrx212 322 3e-110 12..323 25..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 280146..280352 207 N° 2 279891..280082 192 N° 3 279662..279827 166 N° 4 279190..279596 407
complement(join(279190..279596,279662..279827,279891..280082,280146..280352))


exon

Literature and cross-references SmPrx82-2_146 (SmPrx82b_146)
DNA ref. Phytozome 12:   scaffold_146 (280352..279190)
mRNA ref. JGI transcript:   236655
Protein sequence: SmPrx82-2_146 (SmPrx82b_146)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   35509.28 (33021.9)  
PI (pH):   %s   9.29 (8.93) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGDYKVWRVLSLFLLVVIAARGDLSYDFYKTRCPQAEKIVMDVMVNATLSDRRIGASILRMHFHDCFVEGCDGSILIDSTSTNQAEKDFPANFPSIRGFDVIDAAKAAVEKVCPGIVSCADILAFAARDGVHLSHGPFWNIRSGRRDGRVSMFNRVPLFLPPPTSNITQLITSFAAKNLSKSDLVFLSGGHTIGFSLCSSFNSRLYNFTGRGDQDPALDAALAQTLKGQCPRPPTRVDPIVPMEKTPFKVDTKYFKGVLKRRGLFTSDSALLNDPFTKSLVIKSAADESFFLGNFIQSMIKMSELEVKTGSKGEIRKKCHVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGATTATAAGGTTTGGAGAGTTTTGAGCCTGTTCTTGCTTGTTGTCATCGCTGCCCGAGGGGATCTCTCGTATGACTTCTACAAAACGAGATGTCCACAGGCAGAGAAGATTGTC
ATGGATGTCATGGTGAATGCCACATTGTCTGACAGGCGAATTGGTGCGTCCATCTTGCGTATGCATTTCCACGACTGCTTTGTCGAA
GTAAGTTTTGATAAACCTTTGGCTCATAAAAAC
TTAGCATTTGTCAACTCTTTGATTGATCAGGGCTGTGATGGATCCATCCTCATTGATTCCACCTCCACAAACCAGGCCGAGAAGGATTTCCCAGCAAACTTCCCCAGCATTCGCGGCTTT
GATGTGATTGACGCTGCCAAGGCAGCCGTGGAGAAAGTCTGTCCGGGGATCGTGTCTTGTGCTGACATTCTAGCCTTCGCTGCGCGAGATGGTGTTCATCTG
GTATCTTATCTATCATTC
CTAATCATCTTATCGCGAAACTAATCAATCTCTTCTGGTATTCAGTCGCACGGACCATTCTGGAACATCCGGTCGGGACGTCGAGACGGCCGAGTTTCCATGTTTAATCGCGTCCCTCTC
TTCCTTCCACCACCCACATCCAACATCACGCAGCTCATCACCAGCTTCGCAGCCAAGAACTTAAGCAAGAGTGATCTTGTCTTCCTCTCAG
GTACAGTCTCTGCAAGAATCTCTATAGAT
GTGCAAATCTTACGATGGGGTCATTGAATTATCTAGGTGGTCACACGATTGGATTCTCTCTTTGCTCCTCCTTCAACAGCCGGCTCTACAATTTCACCGGGAGAGGCGACCAGGACCCAG
CGCTCGATGCGGCTCTCGCCCAGACTCTCAAAGGGCAGTGCCCTCGTCCTCCAACCAGGGTCGATCCAATCGTCCCAATGGAGAAGACCCCATTCAAAGTAGACACGAAATACTTCAAGG
GAGTGCTCAAGAGGCGCGGCCTCTTCACCTCCGACTCCGCCCTTCTCAATGATCCATTCACGAAGTCTCTGGTGATCAAGAGCGCCGCGGACGAGTCATTCTTCCTTGGGAATTTCATCC
AGTCCATGATCAAGATGAGCGAATTGGAGGTCAAGACTGGATCGAAAGGCGAGATCCGGAAGAAGTGTCACGTCATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGATTATAAGGTTTGGAGAGTTTTGAGCCTGTTCTTGCTTGTTGTCATCGCTGCCCGAGGGGATCTCTCGTATGACTTCTACAAAACGAGATGTCCACAGGCAGAGAAGATTGTC
ATGGATGTCATGGTGAATGCCACATTGTCTGACAGGCGAATTGGTGCGTCCATCTTGCGTATGCATTTCCACGACTGCTTTGTCGAA
GGCTGTGATGGATCCATCCTCATTGATTCCACC
TCCACAAACCAGGCCGAGAAGGATTTCCCAGCAAACTTCCCCAGCATTCGCGGCTTTGATGTGATTGACGCTGCCAAGGCAGCCGTGGAGAAAGTCTGTCCGGGGATCGTGTCTTGTGCT
GACATTCTAGCCTTCGCTGCGCGAGATGGTGTTCATCTG
TCGCACGGACCATTCTGGAACATCCGGTCGGGACGTCGAGACGGCCGAGTTTCCATGTTTAATCGCGTCCCTCTCTTCCTT
CCACCACCCACATCCAACATCACGCAGCTCATCACCAGCTTCGCAGCCAAGAACTTAAGCAAGAGTGATCTTGTCTTCCTCTCAG
GTGGTCACACGATTGGATTCTCTCTTTGCTCCTCC
TTCAACAGCCGGCTCTACAATTTCACCGGGAGAGGCGACCAGGACCCAGCGCTCGATGCGGCTCTCGCCCAGACTCTCAAAGGGCAGTGCCCTCGTCCTCCAACCAGGGTCGATCCAATC
GTCCCAATGGAGAAGACCCCATTCAAAGTAGACACGAAATACTTCAAGGGAGTGCTCAAGAGGCGCGGCCTCTTCACCTCCGACTCCGCCCTTCTCAATGATCCATTCACGAAGTCTCTG
GTGATCAAGAGCGCCGCGGACGAGTCATTCTTCCTTGGGAATTTCATCCAGTCCATGATCAAGATGAGCGAATTGGAGGTCAAGACTGGATCGAAAGGCGAGATCCGGAAGAAGTGTCAC
GTCATCAACTGA

Retrieve as FASTA