Entry information : SmPrx59-1_19 (SmPrx59a_19)
Entry ID 7087
Creation 2009-10-22 (Paula Nunes)
Last sequence changes 2009-10-22 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx59-1_19 (SmPrx59a_19)
Name (synonym) SmPrx59-1_19 (SmPrx59a_19)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx59-1_19
start..stop
S start..stop
SmPrx59-2_61 647 0 1..332 1..333
CmichPrx14 394 2e-138 31..331 42..343
ScucPrx13 393 7e-138 28..331 26..326
PabPrx86 391 3e-137 31..332 25..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 209411..209638 228 N° 2 209693..209887 195 N° 3 209941..210106 166 N° 4 210190..210599 410
join(209411..209638,209693..209887,209941..210106,210190..210599)


exon

Literature and cross-references SmPrx59-1_19 (SmPrx59a_19)
DNA ref. Phytozome 12:   scaffold_19 (209411..210599)
mRNA ref. JGI transcript:   97331
Protein sequence: SmPrx59-1_19 (SmPrx59a_19)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332
PWM (Da):   %s   36461.38  
PI (pH):   %s   9.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLVLHEAAQSATGVQLQNQTQNRQQQQQFLSVDYYKRTCPDVEKIVHQVMVQKFREAPVAAAGTLRIFFHDCMVQGCDASVLVASTSHNKAEKDFDINLSLPGDGFDAVMRAKQAVENRCPRTVSCADILAIASRDLIGMIGGPFWPVKKGRKDSYTSHAARVPGNLPSSKNTVSELMHLFSSKGFTTEEMVALAGAHTAGFAHCKEFNDRIYNWKNTSRIDPTMNPLYAANLRLACPRNVDPTIVANLDVTTSKKFDNVYYQNLQKGLGLLSTDQALFNDPRTKPLVNRFAASQERFFAAFASAMQKLGSIGVKSASQGNIRINCAAFNQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGGTTTTGCACGAAGCAGCACAGAGTGCCACTGGGGTTCAGCTGCAAAATCAAACGCAAAACCGGCAGCAGCAGCAGCAATTCCTGAGTGTGGACTACTACAAGCGCACCTGT
CCAGACGTGGAGAAGATTGTCCACCAAGTCATGGTCCAGAAGTTCAGGGAGGCGCCCGTGGCAGCCGCTGGGACATTGCGCATCTTCTTTCATGACTGCATGGTCCAG
GTAAGAAGATTT
CAGCTCAAAAGCTCAATGCACATATCTTTCCTTCCTCTCCAGGGTTGTGATGCTTCCGTCCTCGTCGCCTCCACCTCCCACAACAAAGCCGAGAAGGATTTCGACATCAACCTCTCACTT
CCGGGCGATGGTTTCGACGCCGTTATGCGAGCCAAGCAGGCTGTCGAGAACAGATGCCCGAGGACAGTCTCGTGTGCCGACATTCTCGCAATTGCGTCGAGAGACCTGATTGGAATG
GTA
CGTCGTCGTCCTCCACAGGGGCAGAAGGAAGCTGAGGCTTGGTTTTGCAGATTGGAGGCCCCTTCTGGCCGGTGAAGAAAGGCCGCAAAGACAGCTACACGTCGCATGCTGCCAGAGTCC
CCGGCAACCTGCCTTCGTCCAAGAACACAGTTTCGGAGCTCATGCATCTCTTCTCGTCCAAAGGATTCACCACCGAAGAAATGGTTGCACTGGCCG
GTAAGTAGCACTCTGAACAAGATT
CCTTGCCTGGATCGATCAATTGGGAAGCTTGCTTGCCGAATGTCTCGGGGTGGGTGCAGGAGCACATACCGCCGGCTTTGCGCATTGCAAAGAGTTCAACGACCGCATCTACAACTGGAA
GAATACATCCCGCATTGATCCCACCATGAATCCGCTGTATGCCGCCAACTTGAGGCTGGCCTGTCCCCGCAACGTGGATCCAACCATCGTCGCCAACTTGGACGTAACAACATCCAAGAA
GTTCGACAACGTCTACTACCAAAACTTGCAAAAGGGACTGGGTTTGTTGAGCACCGACCAGGCCCTGTTTAACGACCCCCGGACGAAGCCTCTGGTGAACAGGTTTGCGGCGTCGCAGGA
GCGATTCTTCGCGGCGTTCGCGTCCGCGATGCAAAAGCTGGGCAGCATCGGCGTCAAGTCGGCTTCACAAGGCAACATCCGGATAAACTGCGCAGCCTTCAACCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGCTGGTTTTGCACGAAGCAGCACAGAGTGCCACTGGGGTTCAGCTGCAAAATCAAACGCAAAACCGGCAGCAGCAGCAGCAATTCCTGAGTGTGGACTACTACAAGCGCACCTGT
CCAGACGTGGAGAAGATTGTCCACCAAGTCATGGTCCAGAAGTTCAGGGAGGCGCCCGTGGCAGCCGCTGGGACATTGCGCATCTTCTTTCATGACTGCATGGTCCAG
GGTTGTGATGCT
TCCGTCCTCGTCGCCTCCACCTCCCACAACAAAGCCGAGAAGGATTTCGACATCAACCTCTCACTTCCGGGCGATGGTTTCGACGCCGTTATGCGAGCCAAGCAGGCTGTCGAGAACAGA
TGCCCGAGGACAGTCTCGTGTGCCGACATTCTCGCAATTGCGTCGAGAGACCTGATTGGAATG
ATTGGAGGCCCCTTCTGGCCGGTGAAGAAAGGCCGCAAAGACAGCTACACGTCGCAT
GCTGCCAGAGTCCCCGGCAACCTGCCTTCGTCCAAGAACACAGTTTCGGAGCTCATGCATCTCTTCTCGTCCAAAGGATTCACCACCGAAGAAATGGTTGCACTGGCCG
GAGCACATACC
GCCGGCTTTGCGCATTGCAAAGAGTTCAACGACCGCATCTACAACTGGAAGAATACATCCCGCATTGATCCCACCATGAATCCGCTGTATGCCGCCAACTTGAGGCTGGCCTGTCCCCGC
AACGTGGATCCAACCATCGTCGCCAACTTGGACGTAACAACATCCAAGAAGTTCGACAACGTCTACTACCAAAACTTGCAAAAGGGACTGGGTTTGTTGAGCACCGACCAGGCCCTGTTT
AACGACCCCCGGACGAAGCCTCTGGTGAACAGGTTTGCGGCGTCGCAGGAGCGATTCTTCGCGGCGTTCGCGTCCGCGATGCAAAAGCTGGGCAGCATCGGCGTCAAGTCGGCTTCACAA
GGCAACATCCGGATAAACTGCGCAGCCTTCAACCAGTAA

Retrieve as FASTA