Entry information : SmPrx61-2_18 (SmPrx61b_18)
Entry ID 7093
Creation 2009-10-22 (Paula Nunes)
Last sequence changes 2009-10-22 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx61-2_18 (SmPrx61b_18)
Name (synonym) SmPrx61-2_18 (SmPrx61b_18)
Class Class III peroxidase    [Orthogroup: Prx351]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx61-2_18
start..stop
S start..stop
SmPrx61-1_19 663 0 1..347 18..357
SmPrx33-2_131 363 9.05e-126 30..343 42..342
SmPrx33-1_84 363 1.61e-125 30..343 42..342
CsaPrx64 347 1.72e-119 34..343 44..340
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7093' 'complement(join(300113..300739,301106..301297,301360..301584))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 301360..301584 223 N° 2 301106..301297 190 N° 3 300113..300739 625  
complement(join(300113..300739,301106..301297,301360..301584))


exon

Literature and cross-references SmPrx61-2_18 (SmPrx61b_18)
DNA ref. Phytozome 12:   scaffold_18 (301584..300113)
mRNA ref. JGI transcript:   96952
Protein sequence: SmPrx61-2_18 (SmPrx61b_18)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   347 (299)
PWM (Da):   %s   37284.31 (31911.2)  
PI (pH):   %s   4.52 (7.37) Peptide Signal:   %s   cut: 27 range:27-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPNYFFFRPPADDPAFAFQAPAWDDQGDGLASNYYAHSCPGVEEI
ARAVLEEAVGRDGRVGASLLRLHFHDCFVS
GCDGSILLDATPELQSEKAATPNRNSARGFEVIDAIKAAVERECEGVVSCADLLAIAARDSVVLSGGHPWEVLLGRRDSLEPNFKGANTDIPAPNSTLSQLIAAFANKGLSTADMVTLSG
SHTVGFSRCSSFTQRLYDHQRSGSPDPDLDPELLRHLQRLCPRGGDANAIAMLDVYSPARFDNSYFANLQLRRGVLSSDQALLTVLSPSSSSENLSEDSLVSGVLVEAYAYDESRFLEAF
GEAMVKLGSIAPLTGDRGEVRRDCRVVNSDEQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGAACTATTTCTTCTTCCGCCCTCCCGCGGATGATCCAGCATTCGCGTTCCAAGCGCCCGCATGGGACGATCAGGGTGATGGTCTCGCTTCAAATTACTACGCGCACTCTTGCCCT
GGCGTGGAAGAGATCGCACGCGCTGTTCTTGAGGAGGCGGTGGGACGTGATGGGCGTGTTGGAGCGTCCCTTCTTCGTCTCCATTTCCACGATTGTTTTGTTAGC
GTAAAAAGCGAAACC
TTGCCTCTCTTTTATGAAAATCGTTTTGGTGTGTCTCTCTCTTCTAGGGGGCTGCGATGGATCCATTCTCTTGGACGCGACGCCGGAGCTCCAGAGCGAGAAGGCGGCCACTCCCAATCG
CAACTCCGCCCGGGGATTCGAGGTCATCGACGCGATCAAGGCGGCCGTGGAGCGGGAGTGCGAGGGCGTGGTGTCGTGCGCGGATCTGCTGGCCATAGCCGCCCGGGATTCCGTTGTTCT
G
GTATGGCTTAGTGTGGATCTCGAGTGCCTGTTTGCTCGGAATTCGTGGTTCATCGTTCTTTCTTCGTTTTCGAGTTCCTCCTTTTCATTTAGTGAACGTAGCTTGCATTCTCTCATTCT
ATTCTTCTTCCGAGCTTGCTTTTCATTGATTCTTTCGAGAGAAAGTGTCGAGCTTGTCTCATTTCATTTTTTTCCCGCCTATTGCATTGCAATCTGGGTGATCCATTCGATACAGAGATT
CGTGTTCTTATGTTACAACATGCAATGCAGCTTCCCATCCACCTGCATTGGCACTGGGAATGATTCGTCGGTGATCGTTCAAGTTTTCCTGCGATACTCTGATATAACTTTAAGTGTTCT
TTGACAGAGAGCGGAGGCCATCCCTGGGAAGTCCTCTTGGGCCGACGAGACAGCCTCGAGCCCAACTTCAAAGGCGCCAACACGGACATCCCTGCGCCAAACTCGACGCTCTCGCAGCTC
ATCGCCGCCTTCGCCAACAAGGGCCTCTCCACCGCCGACATGGTCACCCTCTCCGGCTCCCACACCGTCGGTTTCTCCCGCTGCTCCAGCTTCACCCAGCGCCTCTACGACCACCAGAGG
TCGGGCTCCCCGGACCCCGACCTCGACCCGGAGCTCCTCCGCCACCTCCAGCGCCTCTGCCCGCGCGGCGGCGACGCGAACGCCATCGCCATGCTCGACGTCTACTCCCCGGCTCGCTTC
GACAATAGCTACTTCGCCAACTTGCAGCTTCGCCGGGGGGTGTTGAGCTCGGACCAGGCTCTCCTTACGGTGCTGTCGCCCTCTTCTTCTTCCGAGAACTTGTCCGAGGACTCCCTCGTC
AGTGGGGTCCTGGTGGAAGCCTACGCGTACGACGAGTCGCGGTTCCTGGAGGCGTTTGGCGAAGCCATGGTCAAGCTGGGAAGCATCGCCCCGCTGACTGGCGATCGAGGCGAAGTCCGC
CGGGATTGCCGCGTTGTCAACTCTGATGAGCAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGAACTATTTCTTCTTCCGCCCTCCCGCGGATGATCCAGCATTCGCGTTCCAAGCGCCCGCATGGGACGATCAGGGTGATGGTCTCGCTTCAAATTACTACGCGCACTCTTGCCCT
GGCGTGGAAGAGATCGCACGCGCTGTTCTTGAGGAGGCGGTGGGACGTGATGGGCGTGTTGGAGCGTCCCTTCTTCGTCTCCATTTCCACGATTGTTTTGTTAGC
GGCTGCGATGGATCC
ATTCTCTTGGACGCGACGCCGGAGCTCCAGAGCGAGAAGGCGGCCACTCCCAATCGCAACTCCGCCCGGGGATTCGAGGTCATCGACGCGATCAAGGCGGCCGTGGAGCGGGAGTGCGAG
GGCGTGGTGTCGTGCGCGGATCTGCTGGCCATAGCCGCCCGGGATTCCGTTGTTCTG
AGCGGAGGCCATCCCTGGGAAGTCCTCTTGGGCCGACGAGACAGCCTCGAGCCCAACTTCAAA
GGCGCCAACACGGACATCCCTGCGCCAAACTCGACGCTCTCGCAGCTCATCGCCGCCTTCGCCAACAAGGGCCTCTCCACCGCCGACATGGTCACCCTCTCCGGCTCCCACACCGTCGGT
TTCTCCCGCTGCTCCAGCTTCACCCAGCGCCTCTACGACCACCAGAGGTCGGGCTCCCCGGACCCCGACCTCGACCCGGAGCTCCTCCGCCACCTCCAGCGCCTCTGCCCGCGCGGCGGC
GACGCGAACGCCATCGCCATGCTCGACGTCTACTCCCCGGCTCGCTTCGACAATAGCTACTTCGCCAACTTGCAGCTTCGCCGGGGGGTGTTGAGCTCGGACCAGGCTCTCCTTACGGTG
CTGTCGCCCTCTTCTTCTTCCGAGAACTTGTCCGAGGACTCCCTCGTCAGTGGGGTCCTGGTGGAAGCCTACGCGTACGACGAGTCGCGGTTCCTGGAGGCGTTTGGCGAAGCCATGGTC
AAGCTGGGAAGCATCGCCCCGCTGACTGGCGATCGAGGCGAAGTCCGCCGGGATTGCCGCGTTGTCAACTCTGATGAGCAGTAG

Retrieve as FASTA