Entry information : SmPrx61-1_19 (SmPrx61a_19)
Entry ID 7097
Creation 2009-10-23 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-26 (Toky Ramarohetra)
Peroxidase information: SmPrx61-1_19 (SmPrx61a_19)
Name (synonym) SmPrx61-1_19 (SmPrx61a_19)
Class Class III peroxidase    [Orthogroup: Prx351]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx61-1_19
start..stop
S start..stop
SmPrx61-2_18 663 0 18..357 1..347
SmPrx33-2_131 354 6.83e-122 40..353 42..342
SmPrx33-1_84 353 1.01e-121 40..353 42..342
BrPrx49-1Aa_other 338 1.3e-115 12..354 15..338
Gene structure Fichier Exons


exon

Literature and cross-references SmPrx61-1_19 (SmPrx61a_19)
DNA ref. Phytozome 12:   scaffold_19 (1770673..1769174)
mRNA ref. JGI transcript:   231953 [Incorrect splicing]
Protein sequence: SmPrx61-1_19 (SmPrx61a_19)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (340)
PWM (Da):   %s   38152.71 (36389.9)  
PI (pH):   %s   4.67 (4.61) Peptide Signal:   %s   cut: 18 range:18-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKTLCFFSASMAIACAMPNYFFFRPPADDPAFAFQGDGLASNYYAHSCPGVEEIARAVLEEAVGRDGRVGASLLXRLHFHDCFVSGCDGSILLDATPELQSEKAASPNRNSARGFEVID
AIKAAVERECEGVVSCADLLAIAARDSVVLSGGHPWEVLLGRRDSLEPNFKGANTDIPAPNSTLSQLIAAFANKGLSTADMVTLSGSHTIGFSRCSSFTQRLYDHQRSGSPDPDLDPELL
RHLQRLCPRGGDANAIAMLDVYSPARFDNSYFANLQLRRGVLSSDQALLSVLSPSSSSENLSEDSLVSVGLVEAYAYDESRFLEAFGEAMVKLGSIALTGDRGEVRRDCRVVNSDEQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Incorrect prediction from JGI (short PS and frame shift for the FHDC). No EST.
DNA
Send to BLAST
CDS
Send to BLAST