Entry information : SmPrx63-1_19 (SmPrx63a_19)
Entry ID 7099
Creation 2009-10-22 (Paula Nunes)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-26 (Toky Ramarohetra)
Peroxidase information: SmPrx63-1_19 (SmPrx63a_19)
Name (synonym) SmPrx63-1_19 (SmPrx63a_19)
Class Class III peroxidase    [Orthogroup: Prx095]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx63-1_19
start..stop
S start..stop
SmPrx64-1_19 555 0 1..308 1..322
SmPrx63-2_18 538 0 1..308 1..320
SmPrx64-2_18 531 0 1..308 40..359
SmPrx102-1_50 496 2.24e-179 15..308 23..314
Gene structure Fichier Exons


exon

Literature and cross-references SmPrx63-1_19 (SmPrx63a_19)
DNA ref. JGI genome:   scaffold_19 (2220796..2219759) [Sequencing error]
mRNA ref. JGI transcript:   97201 [Incorrect prediction]
Protein sequence: SmPrx63-1_19 (SmPrx63a_19)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   307
PWM (Da):   %s   33172.88 Transmb domain:   %s   o10-27i
PI (pH):   %s   8.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQRFKYLLLTLTLLRR*XIHQELPLMPSELSTSFYANTCPDFPQIARSVIRSEFANDSRSSASILKLHFRDCFAQGCDGSLLPQVGDGRSTKGLKIINNIKRAVETSCPETVSCADILAL
SARESVIALGGPSWTVEFGRRDNPSSTSVAAAVDAIPSPNLTATQLNERFQKRGLSKRDLVALSGGHSIGQAQCFTFSARLFNGTTGDSIDPALKSRLEKNCPPTAPNRLNNLDPSPTTF
DNLYFRAVQANQSLLFSDQQLLQSDLAGFVKEFADNQKAFCTAFANGMIKMGRLSPLTGGHGEIRASC

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Incorrect prediction from JGI (short PS is missing). No EST.
DNA
Send to BLAST
CDS
Send to BLAST