Entry information : MmulGPx05
Entry ID 710
Creation 2009-02-04 (Christophe Dunand)
Last sequence changes 2009-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-11-22 (Myriam Duval (Scipio))
Peroxidase information: MmulGPx05
Name MmulGPx05
Class Animal glutathione peroxidase    [Orthogroup: Gpx1001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cercopithecidae Macaca
Organism Macaca mulatta (rhesus monkey)    [TaxId: 9544 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MmulGPx05
start..stop
S start..stop
MfaGPx05 460 6.95e-168 1..221 1..221
HsGPx05-A 453 3.1e-165 1..221 1..221
PtroGPx05 445 4.79e-162 1..221 1..221
MmGPx05 368 1.8e-131 1..220 1..220
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '710' 'join(28266599..28266685,28269936..28270089,28272357..28272474,28272896..28272995,28274766..28274969)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28266599..28266685 85 N° 2 28269936..28270089 152 N° 3 28272357..28272474 116 N° 4 28272896..28272995 98
N° 5 28274766..28274969 202  
join(28266599..28266685,28269936..28270089,28272357..28272474,28272896..28272995 ,28274766..28274969)


exon

Literature and cross-references MmulGPx05
DNA ref. GenBank:   NC_007861.1 (28266599..28274969)
mRNA ref. GenBank:   XM_001101143
Protein sequence: MmulGPx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221 (198)
PWM (Da):   %s   25067.92 (22506.5)  
PI (pH):   %s   8.45 (8.30) Peptide Signal:   %s   cut: 24 range:24-221
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTQLRVVHLLPLLLACFVQTSPKQETMKMDCHKDEKGTIYDYEAIALNKNEYVPFKQYVGKHILFVNVATYCGLTAQYPELNALQEELKPYGLVVLGFPCNQFGKQEPGDNKEILPGLKYVRPGGGFVPNFQLFEKGDVNGEKEQKVF
SFL
HSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 4 introns). No EST. Isolate="17573"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACACAGTTAAGGGTCGTCCATCTGCTTCCCCTTCTCCTAGCCTGCTTTGTGCAAACAAGTCCCAAGCAGGAGACGATGAAGAGGTGAGTGAGCTCCAGAGAGGGCATGGTAGTT
ACTCTTCTGTCCTACTTCTAGACCCTGCCCTCCAGTCCTTCTTGTAAGACTCCAACTCCTGCTTTCTTCTTCTTTGCCTGTTCCCCTAAATCTCGCTTTTTTTCTCCTTGAATCTTCTTC
ACTCCTATGGATGGGTGTTCCTTGCGTTGAATATGACTAGGGAAGAAAGGGTCTCTATACTGTAGTCCTTTCTCCCTTTCTTCAGGTGGAGGCCCCCTGGAGACCTCTCCGGCCACATCA
GTCTCTGCTTCAGAGCTGGGTCTGCGGCTGGGACAGCGATGGGCCTTACAGTAGGTGGGGACTGGGGTTTGAAGGAGAAGCTGAGTGGACTCGTCTCAGACACAACTCAGCAAGAACCCC
TTGAAGAGGAGGAAAAAACAAATGTGGAAGTTTTAAGGATGGATAAAGTCAGAGTTATCACAGAAGCATAAAACATGAAAAAAAAAGAATCAGAGCCCTAAAACAACTGGATTTGGGGTC
AGGCATCTTGGATTCTGGCCTCTGTTCTATGCGCAATTAATGGCTCGTTACCTTCTTGATAAGACACATGTGTCTGGCAGCAGAAGGGGCAGTTCAGGAAAGGATAATAATGAATGCGAT
TAACTTGGAGGCAAAAAATAATCATGAAGTTAGGTAAAGGCAAACTTTCATTTACATAATGGGTTACCACTTTTGGCTTTGGACAAATTAACCTCTGTTTTCTCATTGTAAATTTATGGG
TAACAATAACTACCTTGTGGGCGGGTGAACAACAATTTTATGTGTATAATACATTCTACAAAATGCAGTTCTAATAAGATCTCCCCATCCCTCGCCTCTAAAAATAACTAGATAATTTCC
TGGGTGAACTTCTATTTTGAGAATTGATATGGTTTTTATGTTACCTGTGGTGCTTAATTGAGTATGGAGACTCTGGGCTACAGAATTTGCTTAATAAAAGCTGCATTTAGAGATAATTGA
GACATGGCATATAGACTTCAATAAATTTGAAACAGCAGTCAATATCAGAAGTAAACTGGACTAAAAGGAGTCTTCGAACTGGGAGTCTCTCTAAGCTCTTGCCTCCTGGTACCCAACACG
ACTGTGAGTAATTGTCATTGCAGTAGCAAAAGAAACAAAAAGGCAAATTCTTGCAAATGTTTAACTTGATACTAGGCAACATGAAGATAAGAATGGATACTTTCACACAATATTCTCTTT
ATAGATCCCTCAATTTTGCTAGTGCACATATATGTGTATAAATTTAGGGAAAGGCGTAAAAACCTGCATTGAAAAATATCTTTTTCCTCAAGAGTAAGAAGTGAGTAGCTACAACCTAGT
ATGCTAGTGATAAAATCAGTGGGATTACAGGATTCGAAAAGTTGTGTTTTGTTTTGCATTACTCCTTCTCTGAATGGGGGCAGATGGTGTTCAACCAAAATCCTTACTAGACTATTGCAT
TTCCAGGAAGTCTAGTTTAATCGTAGTTTAAGTCTGGACATTCCTTATCAGATAATGCCCTTCTTTCTTTTCTTCAGCCAGTTCCTTTCCACCTTCTTCTCACTGGATGGTTTGGACATA
TAGCTTCCTTTTCATATTCCTATCATATATGTTTTGTATTCCATGAGCAGTTTGTGGCAGCTTCCCCAGTATAAGAAAAGGGATCAGCATGTGCTGGTGAGTACTGTGGCATCAGTACAC
TTTGGGTACTGCATGAACCCTGTAAGGGTAGAGACAAAGGAGGAATAAGATGAGACCTGCCTTGTAGAGGAATTTAATAAAAGAACATGTGATGAGAATTTCAGGCAGGACTAATTTATG
TTATGTGGAACTTAACAAATGTTGCGTGGAAGTCTGCTCAAATATTAATATGTTCATGAGATTTGAGAAGGAAGGGGATAGGCGGAATGGAGGATGAAGGTGGATATTAGACACCTGGAG
CACAATGGGCTGAAGAGCTGGGTGAGTCGTGGGTTGGATGCTGCCGGACAGATTTCAGGGACTTACCTGCAGATGGACTTTAGGGTTCTCCATCTCTTTTCTTGAGAGCTACCAAAACCT
GGGATTTCACAGTATTGGCTTACACGACCACCATATTAGTAGGAGAGTGACGAGAAAGTTATTCGAGGTGAAGATAATATTAGAATCTAGAATGTTAAACATCGAAGCTCACTTGGAATT
CTAGTAAGAATCTAGGTAAATATCTTCATTTTACTCATGGGGAAACTGAAGGCCTGGGATGGGAATTGCCCAGATTCACAGAGGAATTTAACAATGGAACTGGCTTCTGATTCCCAGGAC
AGTGTTCTTTCTACTCTATGTGCTGATGAGTGGAGTAAGAGGTCAGAAGACCTGGGGAAAGAGAAGTAACTAAGTTATCCTAAAAATAGTTCAGCAATTTAAAACACGCCCTTCTCAGAG
AGTCCAGGCAGGAGGCCTTCAATCCAGAGCCAAGGAGTAGCCTCTTTTACAGAGGCATGTAAGGCAAGCGTGCTTTTCTCTTCAGCCCCACTTACTTCCAGCTCCTACCATCCCAGCTTA
TGAATCAACACCCTTTTCCATTATCCATGCATTTCCTGGTATCTCACATCTTTCAAAATAATAGGAAACTTGATTCTTATGTGTGTGTGGTGTGGAGAGGGTACATAATAAGTGTGTATA
TGTATAGGGTACAGGAGATGTTTTGATACGGACATGCAATATGTTATAATCACATTATGGAAAATAGGGTATCCATCCCCTCAAGCGTTTATCCTTTGTGCTATAAACAATCCAATTATA
TGCTTTCAGTTATTTAAAAATGCACAATTAAGTTATTATTGACTACAGTCACCCTGTTGTGCTATCAAATACTGGGTCTTATTCATTCTTTCTAACTATCTTATTTTGTATCCATTAATC
ATCCCAACCTCCCTCCCACCCTCCTAGTATCTTTCCCAGCCTCTGGGAACCACCCTTTTACTCTCTATCTCCATGAGCTCAATTGTTTTCATTTTTAGATCCCACAAATAAGTGAGAAAA
TGCAATGCTTGTCTTTCTCTGCCTGGCTTATGAAACTTGGTTTTTTATTTCCAAGTTACAAGAACCAAGTTTCAGTCTTGTCATTGATACTTTAGACAACTCTTATTTGTTTTCTAGGTC
TTGGTCAGAATGTACCTATTCTTTGACTTCTTTGAAAGATTACACAGATGCTAGGAATTGTTGTTACCAATATTATCACTTTAAAAAAAAATCTTCCAGATGGATTGTCACAAAGATGAG
AAAGGCACCATCTATGACTATGAGGCCATCGCACTTAATAAGAACGAATATGTTCCCTTCAAGCAGTATGTGGGCAAGCACATCCTCTTTGTCAACGTGGCCACCTACTGTGGTCTGACA
GCGCAATATCCTG
TGGTAAGAATTCATAGCTCTTTGGGACTAAATTTTCCAGCTGATTATATTCTAAATTATACTTGGAATTATAGTTTAATTCTAATTATATACCAAAATAAATACTCA
TAAATCAAGTGACTTCATCCCCCATATCAGAAGTCAGCAAGTTCTGGCATACAGGCCAAATTTGGTCAGCCTGGCTTTGTTAACAAAGTTTTATTGGAATGCAGCCATCCCCGTTCATTT
ATACATCACCTATGGCTGCTTTCATGCTGTAAAATAGAGGTCAGTAGTTGTAGGAGTAGTGGTGACGGAAACCATATGGCCCACAAAGTCTGAAGTATTTCCTATCTGGCCCTTTACAGA
AAAAATGTGCTAACCCCTTCCCCATGCCCTGCCTCTGCTTTTCCCTGAGATTTCCAGGGGAATCAATATGTACTTGAGAACTAGGAGCCTCTCAGAAGATTCCAGAAGTCTTCTTGATAA
ATACAGGACAGAAGACCCATGTTTTTGAGACTTTTGCAAGGTTTTACAGGTAACTTACAACGACAAGAAAAAGGAGTTTTATACCTGGAACTGCATTTGATTAGAGTGAGGGCTGGCAGA
TGAGGCTGTAATAGAAGCAAATACTCCCTCTCCAACCTCAACCCCTTTTTAGGATGTAGTTTTTCCTCCCTTTTTGTACATTATTCAGGGAAGAATTTTCTCATATTTTAGGGCACGCTG
TTTAAAAATCAGTGAAAACAAACAGGATGGATTATACCAGAGACAAATGTACTTCTTATATTTGAAGTAATAAGACCTTCATTTTTTGTTTTTAATTATGTTTTGAATAAGTATTATATT
CACAAGTCTCAAAGTTCAAAAGGAAAAAAAATTTGAACCAAAGGTTTCCACCTTCTTCCCCTCCCTTCAGTAGACCAATATTATCATGTTTACAGAATACATAGATATTCTTTTTTCTGC
TTCTCCCTCCCAAGCTGATAACACACTATAAATACTATTTGCTGCCTTGATTTTTTAATTAATAAAATACATTTGAGTTCAGATCATTTCCTCATTCTTTCTTAAGACTGAATAATATTT
ATTGGAACATAATTTATTTTCCCAGTTTATAGGGACTTTAAGAATCGATTTATTCAGTTTCCACCCTGCAAATAACAGACAATGGAAGGATATAGGGAGGGGTACTGAGAAACCCTGTGA
AAACAGGAAGGCAATCTCTGTGTTTTTTTTTTTAAAGGACTAGAGGAGGTGCCAGTTGGCTGAACTGAATCTGAGTGGGACTGGTTAGTGTTTGTCAAGGGACTAAAGGCATCTGGCTCA
GAAAGAGTTAACAAAGAAGCTGATTATAAAAGTCTGAGCAGACAGGTTGGAAAATTTCTTGGTAGTGGACGAAGGCAGCTGAAGCTTGTGTTTCAGCATATCACTGAGGATTTTTAGGAA
GAATGCATCTTCAGCATCGTGAGGATTGTTGAAAAATGTTAGGATAGTTGACTTCAAATTTCTCTGGTTCTCTTTGCCTTTGTCAATTTTACTTCCACTCCACTCAGGGTGAGCCAGGCT
GCACAGAGGAGAGGAGCTCAGTCCTCATTATCTGTGTCTTTTCCTTTAAAAAAGAAAGATTCAGGTCAGGCGCTGTGGCTCACGCCTGTAATCCCAGCATTTTGGGAAGTCGAGGCGGGC
AGATCAGGAGGTCAGGAGATCAAGACCATCCTGGCTAACATGATGAAACCCCGTCTCTACTAAAAATACAAAAAAAATTAGCTGGTCATGGTGGCACGCACCTGTAGTCCCAGCTACTCG
GGAGTCTAAGGCAGGAGAATCGCTTGAACCCAGGAGACGGAGGTTGCAGTGAGCCGAGATCGCGCCACTGCACTCCAGCCCGGGCGACAGAATGAGACTCCGTCTCAAAACAAACAAACA
AACAAACAAAAATCACCTGTTGAGCTTTTGAGTAATAAAAATGACTAAGCCCCATTTCAGAGGAACAGAAAACTCTCTGAAATGGGACCTGGGCATCCCTATTTTTAGGGAAGGGCGTTC
AGCTGATTCTGATGCACTGCAGGTATGGGAAACACTGCACCATAACAGAAGGCTTTTGAGTGCACGTCTGAAGATCCGGCCTCTAACTTCAGCTATGCCACTAACAACCCTTCTGATGTA
CAGCTGTTTCCCTCCCCGGGCCTCTGTTTCCTTCTCTGTAAAATGGGTAACCCCAGGGAAAGATCCCTGCACAAGGCAGAATCTCCACCCAGACCAATATGTTGTCCCTCCTCTAACCAC
AGAACTAAATGCACTCCAGGAGGAGCTGAAGCCCTATGGTCTAGTTGTGCTGGGCTTTCCCTGCAACCAATTTGGAAAGCAAGAACCAGGAGATAACAAAGAGATTCTTCCTGGGCTCAA
AAGTAAGTGTCTTCTTTAAATCCAATAGGAGGTGCCTGTGTACCTTTCCTCAGTCTCCAGAGGCCCTTCCAGCTCAGGAACTTCTGGGGAGGTTTGGATGAATAGGCTCAGGGGCATTGC
AAGCAGCATTTAACTTCGGCCTACCCTGATAAGCGTCTGGCAGTTTCCAGAGACTCTTTCTCCATCCCTGGCTGAGACTTGGACTATGGAAGACAGAAGGGATGGAGGAAAAGAGACGGG
TCATGGGATAGAGAGAGAATAGTGAGTCAGAGAGCCCAAAGCCAAAACATGGCCGTATTCCTCCCTATGCACAATGATACTTTCCTCTTTCTCCCCTTTGTCGTGATTTCGAATCCTAGT
ATCCCATTATAACCTTTACTTGCATATCCTGGAGCTTCCTGGGAACATTATGACTTGTTGCAGGTATGTCCGTCCAGGGGGAGGATTTGTACCTAATTTCCAGCTTTTTGAGAAAGGGGA
TGTGAATGGTGAAAAAGAACAGAAAGTCTTCAGCTTCCTGAAG
AGGTGAGTAAATTCCTGGCATAAGCCGCCTCCTCTTTTCTAATATTCCTAGCATAGAGTTGGTGTGGCAGAAATGGA
TCCAGGGCTCTTATCCCGGCCCGCGGGATAGTCAGAGCAGGCCCTGGAGGAGGGGGGTGGGAATTTGGGGAACAAGAGACACGAGAAAGGTAGACAAGACAGTGCTCTGATCAAGTCTGG
TTTAATGGCGGTAATGCACTGCCTTATATACACTTGGAAGGGAAGGGGTTGGGCTAAGGCGGAAATGATCTCATTGCCGAGGGCGTGGCCAGGTTAGTTTCGGTTTCTCCGGTCAGATGT
CATGTTGCGCTTGTGCTATTTAGTAACAATTTTCCCCGGGCGCGGGAAAAGTGAGTGAAGAAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNGGACCACCCTCTTTTGCTCGTTGACATTCATTCATTCATTCCAGGTACACTTGATGAATGCCTGCTATTTATAAAGCAATCTAAATAATAAGGATAT
AAAGATGAATAAGGCACAGTCTCTACCTTTGATGAGTTTATAGTGGAGAGAGAGTTAGAAACAATTAGCTATCTAGCTGGTTGTGGTGGTTCATGTTTGTAATCCCAGCACTTTGGAAGA
CTAAGGCAGGACAGGAGAATTGCTTGAGTCCAGAAGTTCAAGACCAGCCTGGGCAACATAGTGAGACTCTGTCTCTACAAAACAAATACAAAAATTCCTGGGTGTGGTGGCATGTACCTG
TAGTCTCAGCTACTCGGGAGGCTGAAGTCAGAGGATTGCTTGAGCTCAGGAGCTGGAGGCAGAAGTGAGCTATGATTGTGCCACTGCATTCCACACTAGGCAACCAAGCAAGACACTGTC
TCAAAAAAACAAAAACAAAAACAATAACAAACCAACAGGTATGATACAGGGTAGTAGGTACCTTTTATGAAACACTGATTTTTAGACATAGAGAATGCCAGAGCTGAAAGAACCCTAAAG
ATTACCAAAGTGAATTGTTCCTAAATGCTGGACTGTGAACCAAGACTAGTCCATGTTAAGACTTTATATATCCTCAATAAGTTGAAGACAATAGAACAGTGTATCATGCCTCTGCACCCC
AGCCTGGGGGACACAGCAAGACTTTGTCTCAAAAAAAAAAAAAAAAGAAAAGGAAAAAAAGGAACAGTGTAAGAAGCTTTTTTATGAACTCATCTCGTCTAACTTATAGGGCTTCCCTTT
ATTCACAAATTATGACCCACATGCAGTTTATTTTTCCAATGGTCTTTTTAAATTAAGTGATAAATGATGGTGTTTTAAAAATTTTTGTTTTTTGACAAAATATTAGTAATTCAGTGTTGG
TCCCAAAAGATAATTATTGAAATATTAGTGGCCCATGGAACCCTAAGACCTGGAAAACCACATTCCAATCCAAGCTATTTACTTTGAAGAAAAGGAAACCAAAAGCATAAAAGGTAACAT
GTCTTATCCGTGGCAGCAAAATTTTGTGATAGGGTTATGGGGAGAAACTGAAAGAGAGCAGATTTTGCTATAATATCTATAATATTCTTGGTAGTTGGCATAGTGGTGATTCAAGAATCT
ATGGAGATTTTTAGGAATAACAGGAAGTTAAAATATCTAGGTATAGGAGGGGGTGGATTACCCGTGGGTAAAAATAGCCTGGATCATCCAGGAGCAGAAATAACATTGTTTCTCTTTTCC
ATCTCTCTGCTTTAGCACTCCTGTCCTCATCCCTCTGAGATTTTGGGCACATTCAAATCTATATCCTGGGACCCTGTAAAGGTCCATGACATCCGCTGGAACTTTGAAAAGTTCCTGGTG
GGGCCTGATGGAATCCCTGTCATGCGCTGGTCCCACCGGGCTACCGTCAGCTCAGTCAAGACAGACATCCTGGCGTACTTGAAGCAATTCAAAACCAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACACAGTTAAGGGTCGTCCATCTGCTTCCCCTTCTCCTAGCCTGCTTTGTGCAAACAAGTCCCAAGCAGGAGACGATGAAGATGGATTGTCACAAAGATGAGAAAGGCACCATC
TATGACTATGAGGCCATCGCACTTAATAAGAACGAATATGTTCCCTTCAAGCAGTATGTGGGCAAGCACATCCTCTTTGTCAACGTGGCCACCTACTGTGGTCTGACAGCGCAATATCCT
G
AACTAAATGCACTCCAGGAGGAGCTGAAGCCCTATGGTCTAGTTGTGCTGGGCTTTCCCTGCAACCAATTTGGAAAGCAAGAACCAGGAGATAACAAAGAGATTCTTCCTGGGCTCAAG
TATGTCCGTCCAGGGGGAGGATTTGTACCTAATTTCCAGCTTTTTGAGAAAGGGGATGTGAATGGTGAAAAAGAACAGAAAGTCTTCAGCTTCCTGAAG
CACTCCTGTCCTCATCCCTCT
GAGATTTTGGGCACATTCAAATCTATATCCTGGGACCCTGTAAAGGTCCATGACATCCGCTGGAACTTTGAAAAGTTCCTGGTGGGGCCTGATGGAATCCCTGTCATGCGCTGGTCCCAC
CGGGCTACCGTCAGCTCAGTCAAGACAGACATCCTGGCGTACTTGAAGCAATTCAAAACCAAA

Retrieve as FASTA