1. Browse the Database
  2. View Redoxidase
Entry information : SmPrx91-1_24 (SmPrx91a_24)
Entry ID 7103
Creation 2009-10-22 (Paula Nunes)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-08-12 (Christophe Dunand)
Peroxidase information: SmPrx91-1_24 (SmPrx91a_24)
Name (synonym) SmPrx91-1_24 (SmPrx91a_24)
Class Class III peroxidase    [Orthogroup: Prx249]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx91-1_24
start..stop		 S start..stop
SmPrx91-2_26 662 0 1..322 1..322
SmPrx[P]90a_24 463 6.3e-166 1..320 1..295
SmPrx[P]90b_26 454 3.33e-162 1..320 1..295
SmPrx71-2_98 413 2.64e-146 12..322 10..319
Gene structure Fichier Exons►


exon

Literature and cross-references SmPrx91-1_24 (SmPrx91a_24)
DNA ref. JGI genome:   scaffold_24 (297397..296320)
mRNA ref. JGI transcript:   414521
Protein sequence: SmPrx91-1_24 (SmPrx91a_24)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (299)
PWM (Da):   %s   34959.24 (32581.0)  
PI (pH):   %s   7.9 (7.90) Peptide Signal:   %s   cut: 24 range:24-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSIVSMISIFLLFAMSGHALASLSPTFYSSTCPNLTGIVRAAV
QQVVASEPRMCASLVRLFFHDCHVNGCDASIMLNGSNNEQFAFPNINSLRGYNVIENIKALVEAKCPNTVSCADIIVIVARECVMALNGPTWTVTFGRRDSLTANQTAANVELPPFFLNVSRLIANFQSHGLSVQDLVALSGSHT
IGQGQCGNFKSRLYGPSLSSSPDYMNPYYNQSLRSQCPSSGGDSNLSPLDLQTPVVFDNKYYKNLINFSGLFHSDQTLWSGGDWTVAQLVHTYAMNQARFFQDFATGMINMGNLKPLLAP
NGQIRKYCGKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST