Entry information : SmPrx103-1_73 (SmPrx103a_73)
Entry ID 7118
Creation 2009-10-22 (Paula Nunes)
Last sequence changes 2009-10-22 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx103-1_73 (SmPrx103a_73)
Name (synonym) SmPrx103-1_73 (SmPrx103a_73)
Class Class III peroxidase    [Orthogroup: Prx163]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx103-1_73
start..stop
S start..stop
SmPrx103-2_90 619 0 1..326 1..325
SmPrx73-1_120 459 4e-164 26..325 25..324
SmPrx73-2_39 459 4e-164 26..325 25..324
MpPrx179 380 9e-133 10..323 11..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 189190..189402 213 N° 2 189451..189642 192 N° 3 189689..189854 166 N° 4 189918..190327 410
join(189190..189402,189451..189642,189689..189854,189918..190327)


exon

Literature and cross-references SmPrx103-1_73 (SmPrx103a_73)
DNA ref. Phytozome 12:   scaffold_73 (189190..190327)
mRNA ref. JGI transcript:   182303
EST ref. GenBank:   FE443000.1 [5' end]   FE442999.1 [3' end]
Protein sequence: SmPrx103-1_73 (SmPrx103a_73)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (302)
PWM (Da):   %s   34453.02 (31614.6) Transmb domain:   %s   i2-21o
PI (pH):   %s   7.64 (7.24) Peptide Signal:   %s   cut: 25 range:25-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLVGFVLMSYVFFFFFFLSVGRCQLQTGFYASSCPNAESIVKSEVSKATQQDSRLPASLIRLHFHDCFVQGCDASVLLDDTSSFTGEKTAGPNNNSLRGFEVIDTIKASLESSCKGVVSCADILAIAARDSSVITGGPSWDVRLGRRDSTTASLSGANSQIPSPAFTVNQLISAFTAKGLSAEDMFTLSGAHTIGQAKCSSFSGRLFNNSGSGQPDPSIRPGFLKSLQSACPQGGDATALQPLDVATATTFDNQYYSNLLLGRGLLNSDQVLSTTVGTARNFVKAYSSDQSKFFSNFAGSMINMGNISPLTTPNGIIRSNCRVPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTGGTGGGATTCGTCCTCATGTCTTACGTCTTCTTCTTCTTCTTCTTCTTGTCCGTGGGGCGATGCCAGCTTCAAACGGGCTTCTATGCGTCTTCATGCCCAAACGCTGAATCC
ATAGTCAAGTCGGAGGTTTCCAAAGCGACGCAGCAGGACTCGAGATTGCCGGCGTCGTTGATAAGGCTCCATTTCCATGATTGCTTTGTTCAA
GTGAGTGCCACTGATCAATTCGTTGAA
TCAGTATTTTTTGTTCCTCAGGGGTGTGATGCATCGGTGCTGCTGGATGATACGTCGAGTTTTACCGGGGAGAAGACTGCCGGTCCAAACAACAATTCACTCCGAGGCTTCGAGGTCATC
GACACGATCAAAGCGTCTCTGGAGAGCAGCTGCAAGGGAGTCGTGTCGTGCGCAGACATCCTCGCCATTGCGGCTCGTGATTCCAGTGTCATC
GTAAGCGAATTTATCTCCGTATTGGGA
TCAATATAAGCTTTTGCAGACGGGAGGACCTTCTTGGGATGTGAGGCTGGGGCGTCGAGACAGTACCACGGCCAGCCTGAGCGGAGCTAATTCACAGATTCCATCCCCTGCTTTCACCGT
TAATCAGCTCATATCCGCATTCACGGCCAAAGGCCTGTCAGCGGAGGACATGTTCACCCTCTCAG
GCAAGTGCAAGCTCATTAGAGTCGCATCAGGATCTTATGGAAACGGCATCTATGG
ATATGCAGGGGCTCACACAATCGGGCAGGCCAAGTGCAGCAGCTTCAGCGGCCGACTGTTCAACAACAGTGGCAGCGGGCAGCCGGACCCAAGCATCAGGCCGGGATTCTTGAAGTCTCT
TCAGTCGGCATGTCCTCAAGGGGGGGACGCCACCGCGCTACAGCCTCTGGACGTGGCAACCGCCACCACCTTTGACAACCAGTACTACTCCAACCTCCTCCTGGGCAGGGGCTTGCTTAA
CTCGGACCAGGTCCTCTCTACCACCGTCGGGACTGCCAGGAACTTTGTCAAGGCCTACAGCTCCGACCAGTCCAAGTTCTTCAGCAACTTCGCGGGATCCATGATCAACATGGGGAACAT
CAGCCCCCTCACCACGCCCAATGGAATCATCCGCTCAAACTGCCGGGTCCCCAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTGGTGGGATTCGTCCTCATGTCTTACGTCTTCTTCTTCTTCTTCTTCTTGTCCGTGGGGCGATGCCAGCTTCAAACGGGCTTCTATGCGTCTTCATGCCCAAACGCTGAATCC
ATAGTCAAGTCGGAGGTTTCCAAAGCGACGCAGCAGGACTCGAGATTGCCGGCGTCGTTGATAAGGCTCCATTTCCATGATTGCTTTGTTCAA
GGGTGTGATGCATCGGTGCTGCTGGAT
GATACGTCGAGTTTTACCGGGGAGAAGACTGCCGGTCCAAACAACAATTCACTCCGAGGCTTCGAGGTCATCGACACGATCAAAGCGTCTCTGGAGAGCAGCTGCAAGGGAGTCGTGTCG
TGCGCAGACATCCTCGCCATTGCGGCTCGTGATTCCAGTGTCATC
ACGGGAGGACCTTCTTGGGATGTGAGGCTGGGGCGTCGAGACAGTACCACGGCCAGCCTGAGCGGAGCTAATTCA
CAGATTCCATCCCCTGCTTTCACCGTTAATCAGCTCATATCCGCATTCACGGCCAAAGGCCTGTCAGCGGAGGACATGTTCACCCTCTCAG
GGGCTCACACAATCGGGCAGGCCAAGTGC
AGCAGCTTCAGCGGCCGACTGTTCAACAACAGTGGCAGCGGGCAGCCGGACCCAAGCATCAGGCCGGGATTCTTGAAGTCTCTTCAGTCGGCATGTCCTCAAGGGGGGGACGCCACCGCG
CTACAGCCTCTGGACGTGGCAACCGCCACCACCTTTGACAACCAGTACTACTCCAACCTCCTCCTGGGCAGGGGCTTGCTTAACTCGGACCAGGTCCTCTCTACCACCGTCGGGACTGCC
AGGAACTTTGTCAAGGCCTACAGCTCCGACCAGTCCAAGTTCTTCAGCAACTTCGCGGGATCCATGATCAACATGGGGAACATCAGCCCCCTCACCACGCCCAATGGAATCATCCGCTCA
AACTGCCGGGTCCCCAGCTAG

Retrieve as FASTA