Entry information : SmPrx103-2_90 (SmPrx103b_90)
Entry ID 7119
Creation 2009-10-30 (Christophe Dunand)
Last sequence changes 2011-01-26 (Toky Ramarohetra)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-26 (Toky Ramarohetra)
Peroxidase information: SmPrx103-2_90 (SmPrx103b_90)
Name (synonym) SmPrx103-2_90 (SmPrx103b_90)
Class Class III peroxidase    [Orthogroup: Prx214]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx103-2_90
start..stop
S start..stop
SmPrx103-1_73 647 0 1..325 1..326
SmPrx73-2_39 457 3.29e-163 25..324 25..324
SmPrx73-1_120 456 3.43e-163 25..324 25..324
MpPrx179 376 3.05e-131 3..322 9..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7119' 'complement(join(489924..490333,490397..490562,490619..490810,490859..491068))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 490859..491068 208 N° 2 490619..490810 190 N° 3 490397..490562 164 N° 4 489924..490333 408
complement(join(489924..490333,490397..490562,490619..490810,490859..491068))


exon

Literature and cross-references SmPrx103-2_90 (SmPrx103b_90)
DNA ref. Phytozome 12:   scaffold_90 (491068..489924)
mRNA ref. JGI transcript:   128463 [Incorrect splicing]
Protein sequence: SmPrx103-2_90 (SmPrx103b_90)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   34340.92 (31675.6) Transmb domain:   %s   o4-21i
PI (pH):   %s   7.64 (7.24) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSVGFVLMSYVFFFFFLSVGRCQLQTGFYASSCPNAESIVKSEV
SKATQQDSRLPASLIRLHFHDCFVQ
GCDASVLLDDTSSFTGEKTAGPNNNSLRGFEVIDTIKTSLESSCKGVVSCADILAIAARDSSVITGGPSWDVRLGRRDSTTASLSGANSQIPSPAFTVNQLISAFTAKGLSAEDMFTLSG
AHTIGQAKCSSFSGRLFNNSGSGQPDPSIRQGFLKSLQSACPQGGDATALQPLDVATATTFDNQYYSNLLLGRGLLNSDQVLSTTVGTARNFVKAYSSDQSKFFSNFAGSMINMGNISPL
TTPNGIIRSNCRVPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Incorrect transcript prediction from JGI (short PS is missing, incorrect splicing of intron 2 and no prediction intron 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCGGTGGGATTTGTCCTCATGTCTTACGTCTTCTTCTTCTTCTTCTTGTCCGTGGGGCGATGCCAGCTTCAAACGGGCTTCTATGCGTCTTCATGCCCAAACGCTGAATCCATA
GTCAAGTCGGAGGTTTCCAAAGCGACGCAGCAGGACTCGAGATTGCCGGCGTCGTTGATAAGGCTCCATTTCCATGATTGCTTTGTTCAA
GTGAGTGCCACTGGTCAATTCGTTGAATCA
GTATTTTTTGTTCCTCAGGGGGGTGTGATGCATCGGTGCTGCTGGATGATACGTCGAGTTTTACTGGGGAGAAGACTGCCGGTCCAAACAACAATTCACTCCGAGGCTTCGAGGTCATCG
ACACGATCAAAACGTCTCTGGAGAGCAGCTGCAAGGGAGTCGTGTCGTGCGCAGACATCCTCGCCATTGCGGCTCGTGATTCCAGTGTCATC
GTAAGCGAATTTATCTCTCGTATTGGGA
TCAATATATGATTCGCAAGCTTTTGCAGACACGGGAGGACCTTCTTGGGATGTGAGGCTGGGGCGTCGAGACAGTACCACGGCCAGCCTGAGCGGAGCTAATTCACAGATTCCATCCCCT
GCTTTCACCGTTAATCAGCTCATATCCGCATTCACGGCCAAAGGCCTGTCAGCGGAGGACATGTTCACCCTCTCAG
GCAAGTGCAAGCTCATTAGAGTCGCATCAGGATCTTATGGAAAC
GGCATCTATGGATATGCAGGGGGGCTCACACAATCGGGCAGGCTAAGTGCAGCAGCTTCAGCGGCCGACTGTTCAACAACAGTGGCAGCGGGCAACCGGACCCAAGCATCAGGCAGGGAT
TCTTGAAGTCTCTTCAGTCGGCATGTCCTCAAGGGGGGGACGCCACCGCGCTACAGCCTCTGGACGTGGCAACCGCCACCACCTTTGATAACCAGTACTACTCCAACCTCCTCCTGGGCA
GGGGCTTGCTTAACTCGGACCAGGTCCTCTCTACCACCGTCGGGACTGCCAGGAACTTTGTCAAGGCCTACAGCTCCGACCAGTCCAAGTTCTTCAGCAACTTCGCGGGATCCATGATCA
ACATGGGGAACATCAGCCCCCTCACCACGCCCAATGGAATCATCCGCTCAAACTGCCGGGTCCCCAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCGGTGGGATTTGTCCTCATGTCTTACGTCTTCTTCTTCTTCTTCTTGTCCGTGGGGCGATGCCAGCTTCAAACGGGCTTCTATGCGTCTTCATGCCCAAACGCTGAATCCATA
GTCAAGTCGGAGGTTTCCAAAGCGACGCAGCAGGACTCGAGATTGCCGGCGTCGTTGATAAGGCTCCATTTCCATGATTGCTTTGTTCAA
GGGTGTGATGCATCGGTGCTGCTGGATGAT
ACGTCGAGTTTTACTGGGGAGAAGACTGCCGGTCCAAACAACAATTCACTCCGAGGCTTCGAGGTCATCGACACGATCAAAACGTCTCTGGAGAGCAGCTGCAAGGGAGTCGTGTCGTGC
GCAGACATCCTCGCCATTGCGGCTCGTGATTCCAGTGTCATC
ACGGGAGGACCTTCTTGGGATGTGAGGCTGGGGCGTCGAGACAGTACCACGGCCAGCCTGAGCGGAGCTAATTCACAG
ATTCCATCCCCTGCTTTCACCGTTAATCAGCTCATATCCGCATTCACGGCCAAAGGCCTGTCAGCGGAGGACATGTTCACCCTCTCAG
GGGCTCACACAATCGGGCAGGCTAAGTGCAGC
AGCTTCAGCGGCCGACTGTTCAACAACAGTGGCAGCGGGCAACCGGACCCAAGCATCAGGCAGGGATTCTTGAAGTCTCTTCAGTCGGCATGTCCTCAAGGGGGGGACGCCACCGCGCTA
CAGCCTCTGGACGTGGCAACCGCCACCACCTTTGATAACCAGTACTACTCCAACCTCCTCCTGGGCAGGGGCTTGCTTAACTCGGACCAGGTCCTCTCTACCACCGTCGGGACTGCCAGG
AACTTTGTCAAGGCCTACAGCTCCGACCAGTCCAAGTTCTTCAGCAACTTCGCGGGATCCATGATCAACATGGGGAACATCAGCCCCCTCACCACGCCCAATGGAATCATCCGCTCAAAC
TGCCGGGTCCCCAGCTAG

Retrieve as FASTA