Entry information : SmPrx88-1_24 (SmPrx88a_24)
Entry ID 7122
Creation 2009-10-30 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: SmPrx88-1_24 (SmPrx88a_24)
Name (synonym) SmPrx88-1_24 (SmPrx88a_24)
Class Class III peroxidase    [Orthogroup: Prx073]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx88-1_24
start..stop
S start..stop
SmPrx88-2_26 644 0 1..320 1..321
SmPrx87-2_26 427 1e-151 6..320 6..320
SmPrx87-1_24 427 1e-151 9..320 9..320
SmPrx64-1_19 374 9e-131 24..316 38..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 290218..290430 213 N° 2 289952..290128 177 N° 3 289263..289835 573  
complement(join(289263..289835,289952..290128,290218..290430))


exon

Literature and cross-references SmPrx88-1_24 (SmPrx88a_24)
DNA ref. Phytozome 12:   scaffold_24 (290430..289263)
Protein sequence: SmPrx88-1_24 (SmPrx88a_24)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (296)
PWM (Da):   %s   33830.55 (31144.2)  
PI (pH):   %s   4.58 (4.64) Peptide Signal:   %s   cut: 25 range:25-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDRFGAWWWSSVIAVLLLGLEANAQLSSSFYSSTCPNLTDIVRNVIQSAVANENRMAASILRLHFHDCFVNGCDGSVLLQGGEENAPPNQRSARGFEVIDSVKSAVESACPGVVSCADILALSAHESVTALGGPSWTVVFGRRDSLSPASVADVSANLPGPGFTALRLIRSFQNQDLSPRDLVALSGGHTIGQAQCFTFRARLYNGTAGDSIDPALKSRLEQNCPPSAPNGDRNLENLDTSPATFDNTYFQLLQSTQGLLFSDQQLLSGGQSELASMVNEFAGDQQAFFTAFANGMVSMGNLSPLTGSSGEIRATCRSSN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Incorrect prediction from Phytozome (fusion of the exon 1 from one ORF with exons 2,3,4 from a second ORF)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCGTTTTGGAGCATGGTGGTGGTCGTCTGTGATAGCAGTGCTGCTGCTGGGCCTGGAAGCAAACGCCCAGCTCTCCAGTTCCTTCTACTCCAGCACTTGCCCCAATCTCACCGAT
ATCGTGAGGAACGTAATCCAGTCGGCTGTGGCCAACGAGAATCGAATGGCGGCATCGATCCTTCGCCTCCACTTTCACGACTGCTTCGTTAAC
GTAAGCAAAGAAGAATGAGCGCGTTTT
TCAAATTTCGGGAATGTCCTGTGAATATGCTCCCTGACTTTAAAATTCTTTGCTCATGGCAGGGCTGTGATGGATCAGTGCTCCTCCAGGGCGGGGAGGAGAACGCTCCCCCCAACCAAC
GCTCCGCCAGAGGATTCGAAGTCATCGATAGCGTCAAGAGCGCCGTGGAGAGCGCCTGCCCGGGAGTCGTCTCCTGCGCCGACATCCTCGCACTGAGCGCCCACGAATCCGTCACAGCA
G
TAAGTCACCACTCGATCCACTATCCAATTCGATCGATCCACGAGCGAATTCGATCGACCCAAGAGCCAATTGTCCCGAGCTCACTGACCCAGACCGCGTTTCGCCTTGTTTGCAGCTGGG
AGGACCCTCGTGGACAGTGGTGTTTGGCCGACGAGACAGCCTCAGCCCCGCGAGCGTGGCCGACGTGAGCGCCAACCTCCCGGGACCAGGATTCACGGCATTGCGTCTCATCAGAAGCTT
CCAGAACCAAGACCTCTCCCCGCGCGACCTGGTGGCTCTCTCGGGAGGCCACACCATCGGCCAGGCCCAGTGCTTCACATTTCGCGCTCGCCTCTACAATGGCACCGCGGGAGACAGCAT
CGATCCGGCGCTCAAGTCCCGGCTCGAGCAAAACTGCCCCCCAAGCGCTCCAAACGGCGACAGGAACTTGGAGAACCTAGACACCTCTCCCGCCACCTTTGATAACACGTACTTCCAGTT
GCTCCAGTCAACGCAGGGATTACTCTTCTCTGACCAGCAGCTCCTGTCGGGCGGTCAGAGCGAGCTGGCCAGCATGGTCAACGAGTTTGCGGGCGACCAGCAGGCATTCTTTACCGCGTT
TGCCAATGGGATGGTGAGCATGGGCAACCTTTCGCCTCTCACGGGGAGCAGTGGTGAGATCCGAGCAACCTGTCGCTCCTCAAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATCGTTTTGGAGCATGGTGGTGGTCGTCTGTGATAGCAGTGCTGCTGCTGGGCCTGGAAGCAAACGCCCAGCTCTCCAGTTCCTTCTACTCCAGCACTTGCCCCAATCTCACCGAT
ATCGTGAGGAACGTAATCCAGTCGGCTGTGGCCAACGAGAATCGAATGGCGGCATCGATCCTTCGCCTCCACTTTCACGACTGCTTCGTTAAC
GGCTGTGATGGATCAGTGCTCCTCCAG
GGCGGGGAGGAGAACGCTCCCCCCAACCAACGCTCCGCCAGAGGATTCGAAGTCATCGATAGCGTCAAGAGCGCCGTGGAGAGCGCCTGCCCGGGAGTCGTCTCCTGCGCCGACATCCTC
GCACTGAGCGCCCACGAATCCGTCACAGCA
CTGGGAGGACCCTCGTGGACAGTGGTGTTTGGCCGACGAGACAGCCTCAGCCCCGCGAGCGTGGCCGACGTGAGCGCCAACCTCCCGGGA
CCAGGATTCACGGCATTGCGTCTCATCAGAAGCTTCCAGAACCAAGACCTCTCCCCGCGCGACCTGGTGGCTCTCTCGGGAGGCCACACCATCGGCCAGGCCCAGTGCTTCACATTTCGC
GCTCGCCTCTACAATGGCACCGCGGGAGACAGCATCGATCCGGCGCTCAAGTCCCGGCTCGAGCAAAACTGCCCCCCAAGCGCTCCAAACGGCGACAGGAACTTGGAGAACCTAGACACC
TCTCCCGCCACCTTTGATAACACGTACTTCCAGTTGCTCCAGTCAACGCAGGGATTACTCTTCTCTGACCAGCAGCTCCTGTCGGGCGGTCAGAGCGAGCTGGCCAGCATGGTCAACGAG
TTTGCGGGCGACCAGCAGGCATTCTTTACCGCGTTTGCCAATGGGATGGTGAGCATGGGCAACCTTTCGCCTCTCACGGGGAGCAGTGGTGAGATCCGAGCAACCTGTCGCTCCTCAAAC
TAA

Retrieve as FASTA