Entry information : SmPrx26-1_56 (SmPrx26a_56)
Entry ID 7126
Creation 2009-11-06 (Paula Nunes)
Last sequence changes 2009-11-06 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx26-1_56 (SmPrx26a_56)
Name (synonym) SmPrx26-1_56 (SmPrx26a_56)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx26-1_56
start..stop
S start..stop
SmPrx26-2_6 662 0 1..331 1..331
AtrPrx04 322 8.57e-110 23..328 35..336
AtrPrx17 320 5.11e-109 23..328 35..336
OsPrx23 320 8.71e-109 23..324 39..337
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7126' 'join(7981..8187,8243..8437,8493..8661,8716..9140)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7981..8187 205 N° 2 8243..8437 193 N° 3 8493..8661 167 N° 4 8716..9140 423
join(7981..8187,8243..8437,8493..8661,8716..9140)


exon

Literature and cross-references SmPrx26-1_56 (SmPrx26a_56)
DNA ref. Phytozome 12:   scaffold_56 (7981..9140)
mRNA ref. JGI transcript:   228898
Protein sequence: SmPrx26-1_56 (SmPrx26a_56)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (313)
PWM (Da):   %s   35808.23 (33926.1)  
PI (pH):   %s   7.83 (7.64) Peptide Signal:   %s   cut: 19 range:19-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLARGLCVLTIALVVLCDEGPALNYSYYAKTCPRAESIVSSSIR
TFLRRDRSEVAGLLRIIFHDCFVQ
GCDASVLLVGLNGKESEQQAVPNLTLRPKSLQAITDIKARLEKACPGTVSCADIIALATRDAVNLAGGPWFPLPTGRKDSKSFASVQETLNNLPPPSFNASELLESFQSKGLNATDLVAL
S
GAHTVGKAHCPTFSGRLRPSLDPDLDINFAQKLAATCREGDDDFATSNSTDLDSSTPNRFDNAYYRNLLRKKGLLTSDQQLFVDNRTSSLVEAFACSQRSFFSQFAASFVKLSKIQVLT
GSEGEVRINCSVANPSRMLYDA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTTGCACGAGGCTTGTGCGTTTTAACAATCGCTCTTGTAGTTCTATGCGACGAGGGCCCTGCATTGAATTATTCTTACTATGCTAAGACATGTCCCCGGGCTGAATCCATTGTC
AGCTCCAGCATCAGAACGTTTTTAAGGCGGGACAGGAGTGAAGTCGCGGGGCTGCTGCGAATAATTTTCCACGACTGTTTCGTTCAG
AGGCAAGTTATTTGTTTGGTTTTCAAGTTGATT
CAGGTAAATGCAAAAATCTTGCAGGGATGTGACGCGTCTGTTCTTCTCGTGGGCCTCAACGGCAAAGAGTCCGAGCAGCAGGCAGTTCCAAATCTAACTCTACGCCCAAAATCCTTGCAA
GCGATCACCGACATCAAGGCACGTCTAGAAAAGGCTTGCCCCGGCACTGTCTCGTGCGCAGATATAATCGCATTAGCCACCCGAGACGCTGTCAACCTG
TGGTAAGCTTTCCAACGTCCT
TGTTTATGCTCTTGGCTTGTAATTTCCTCTACTTAGGCTGGCGGCCCCTGGTTCCCTCTCCCCACCGGTCGCAAAGACAGCAAAAGCTTTGCAAGTGTGCAGGAGACCCTCAACAACTTG
CCTCCACCGTCTTTCAACGCCTCTGAGCTGCTGGAGAGCTTCCAAAGCAAGGGGTTGAACGCTACTGATCTCGTCGCTCTGTCAG
AGGTAAGTTTGCTCGAGAGTTTAAAAGAGCCACTC
TAATGCATTGAATCCAAACAGGTGCTCACACGGTCGGCAAAGCCCACTGCCCGACGTTCTCCGGCCGCTTGCGTCCATCGCTGGACCCCGACTTGGACATAAATTTCGCCCAAAAGCTGG
CGGCGACTTGCCGGGAAGGCGACGACGACTTCGCGACCTCAAACTCCACGGATCTCGACAGCTCCACTCCAAACCGATTCGACAACGCGTACTACAGGAACCTGTTGAGGAAGAAGGGGC
TTCTCACCTCGGACCAGCAGCTGTTCGTGGACAATCGCACGAGCAGCCTGGTGGAAGCGTTCGCGTGCAGCCAGCGCTCCTTCTTCTCGCAGTTTGCGGCGTCGTTCGTCAAGCTCAGCA
AGATCCAAGTGCTCACTGGGAGCGAGGGGGAGGTCCGGATCAATTGCTCCGTTGCCAATCCATCGCGAATGCTCTACGATGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTTGCACGAGGCTTGTGCGTTTTAACAATCGCTCTTGTAGTTCTATGCGACGAGGGCCCTGCATTGAATTATTCTTACTATGCTAAGACATGTCCCCGGGCTGAATCCATTGTC
AGCTCCAGCATCAGAACGTTTTTAAGGCGGGACAGGAGTGAAGTCGCGGGGCTGCTGCGAATAATTTTCCACGACTGTTTCGTTCAG
GGATGTGACGCGTCTGTTCTTCTCGTGGGCCTC
AACGGCAAAGAGTCCGAGCAGCAGGCAGTTCCAAATCTAACTCTACGCCCAAAATCCTTGCAAGCGATCACCGACATCAAGGCACGTCTAGAAAAGGCTTGCCCCGGCACTGTCTCGTGC
GCAGATATAATCGCATTAGCCACCCGAGACGCTGTCAACCTG
GCTGGCGGCCCCTGGTTCCCTCTCCCCACCGGTCGCAAAGACAGCAAAAGCTTTGCAAGTGTGCAGGAGACCCTCAAC
AACTTGCCTCCACCGTCTTTCAACGCCTCTGAGCTGCTGGAGAGCTTCCAAAGCAAGGGGTTGAACGCTACTGATCTCGTCGCTCTGTCAG
GTGCTCACACGGTCGGCAAAGCCCACTGC
CCGACGTTCTCCGGCCGCTTGCGTCCATCGCTGGACCCCGACTTGGACATAAATTTCGCCCAAAAGCTGGCGGCGACTTGCCGGGAAGGCGACGACGACTTCGCGACCTCAAACTCCACG
GATCTCGACAGCTCCACTCCAAACCGATTCGACAACGCGTACTACAGGAACCTGTTGAGGAAGAAGGGGCTTCTCACCTCGGACCAGCAGCTGTTCGTGGACAATCGCACGAGCAGCCTG
GTGGAAGCGTTCGCGTGCAGCCAGCGCTCCTTCTTCTCGCAGTTTGCGGCGTCGTTCGTCAAGCTCAGCAAGATCCAAGTGCTCACTGGGAGCGAGGGGGAGGTCCGGATCAATTGCTCC
GTTGCCAATCCATCGCGAATGCTCTACGATGCTTGA

Retrieve as FASTA