Entry information : SmPrx26-2_6 (SmPrx26b_6)
Entry ID 7127
Creation 2009-11-06 (Paula Nunes)
Last sequence changes 2009-11-06 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx26-2_6 (SmPrx26b_6)
Name (synonym) SmPrx26-2_6 (SmPrx26b_6)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx26-2_6
start..stop
S start..stop
SmPrx26-1_56 662 0 1..331 1..331
SbPrx69 322 2e-109 22..323 39..337
GbPrx18 322 4e-109 23..325 60..358
OsPrx23 321 4e-109 24..324 40..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 879004..879210 207 N° 2 879266..879460 195 N° 3 879516..879684 169 N° 4 879739..880163 425
join(879004..879210,879266..879460,879516..879684,879739..880163)


exon

Literature and cross-references SmPrx26-2_6 (SmPrx26b_6)
DNA ref. Phytozome 12:   scaffold_6 (879004..880163)
mRNA ref. JGI transcript:   230656 [Incorrect prediction]
EST ref. GenBank:   FE491958.1 [5' end]   FE511362.1 [3' end]
Protein sequence: SmPrx26-2_6 (SmPrx26b_6)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (313)
PWM (Da):   %s   35844.16 (33962.1)  
PI (pH):   %s   7.6 (7.25) Peptide Signal:   %s   cut: 19 range:19-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLARGLCVLTIALVVLCDEGPALNYSYYAKTCPRAESIVSSSIRTFLRRDRSEVAGLLRIFFHDCFVQGCDASVLLMGLNGKESEQQAVPNLTLRPKSLQAITDIKARLEKACPGTVSCADIIALATRDAVNEAGGPWFPLPTGRKDSKSFASVQETLNNLPPPSFNASELLESFQSKGLNATDLVALSGAHTVGKAHCPTFSGRLRPSLDPDLDINFAQKLAATCREGDDDFATSNSTDLDSSTPNRFDNAYYRNLLGKKGLLTSDQQLFVDNRTSSLVEAFARSQRSFFSQFAASFVKLSKIQVLTGSEGEVRINCSVANPSRMLYDA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 4 ESTs (FE491957.1, FE511363.1). Incorrect transcript prediction from JGI (2 extra intron in the 5'end and incorrect prediction of the first intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTTGCACGAGGCTTGTGCGTTTTAACAATCGCTCTTGTAGTTCTATGCGACGAGGGCCCTGCATTGAATTATTCTTACTATGCTAAGACATGTCCCCGGGCTGAATCCATTGTC
AGCTCCAGCATCAGAACGTTTTTAAGGCGGGACAGGAGTGAAGTCGCCGGGCTGCTGCGAATATTTTTCCACGACTGCTTCGTTCAG
GCAAGTTATTCGTTTGGTTTTCAAGTTGATTCA
GGTAAATGCAAAAATCTTGCAGGGATGTGACGCGTCTGTTCTTCTCATGGGCCTCAACGGCAAAGAGTCCGAGCAGCAGGCAGTTCCAAATCTAACTCTACGCCCAAAATCCTTGCAAGC
GATCACCGACATCAAGGCACGTCTAGAAAAGGCTTGCCCCGGGACTGTCTCGTGCGCAGATATAATCGCATTAGCCACCCGAGACGCTGTCAACGAG
GTAAGCTTTCCAACGTCCTTGTT
TATGCTCTTGGCTTGTAATTTCCTCTACTTAGGCTGGCGGCCCCTGGTTCCCTCTCCCCACCGGTCGCAAAGACAGCAAAAGCTTTGCAAGTGTGCAGGAGACCCTCAACAACTTGCCTC
CACCGTCTTTCAACGCCTCTGAGCTGCTGGAGAGCTTCCAAAGCAAGGGGTTGAACGCTACTGATCTCGTCGCTCTGTCAG
GTAAGTTTGCTCGAGAGTTTAAAAGAGCCGCTCTAATGC
ATTGAATCTAAACAGGTGCTCACACGGTCGGCAAAGCCCACTGCCCGACGTTCTCCGGCCGCTTGCGTCCATCGCTGGACCCCGACTTGGACATAAATTTCGCCCAAAAGCTGGCGGCGA
CTTGCCGGGAAGGCGACGACGACTTCGCGACCTCAAACTCCACGGATCTCGACAGCTCCACTCCAAACCGATTCGACAACGCGTACTACAGGAACCTGTTGGGGAAGAAGGGGCTTCTCA
CCTCGGACCAGCAGCTGTTCGTGGACAATCGCACGAGCAGCCTGGTGGAAGCGTTCGCGCGCAGCCAGCGCTCCTTCTTCTCGCAGTTTGCGGCGTCGTTCGTCAAGCTCAGCAAGATCC
AAGTGCTCACTGGGAGCGAGGGGGAGGTCCGGATCAATTGCTCCGTTGCCAATCCATCGCGAATGCTCTACGATGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTTGCACGAGGCTTGTGCGTTTTAACAATCGCTCTTGTAGTTCTATGCGACGAGGGCCCTGCATTGAATTATTCTTACTATGCTAAGACATGTCCCCGGGCTGAATCCATTGTC
AGCTCCAGCATCAGAACGTTTTTAAGGCGGGACAGGAGTGAAGTCGCCGGGCTGCTGCGAATATTTTTCCACGACTGCTTCGTTCAG
GGATGTGACGCGTCTGTTCTTCTCATGGGCCTC
AACGGCAAAGAGTCCGAGCAGCAGGCAGTTCCAAATCTAACTCTACGCCCAAAATCCTTGCAAGCGATCACCGACATCAAGGCACGTCTAGAAAAGGCTTGCCCCGGGACTGTCTCGTGC
GCAGATATAATCGCATTAGCCACCCGAGACGCTGTCAACGAG
GCTGGCGGCCCCTGGTTCCCTCTCCCCACCGGTCGCAAAGACAGCAAAAGCTTTGCAAGTGTGCAGGAGACCCTCAAC
AACTTGCCTCCACCGTCTTTCAACGCCTCTGAGCTGCTGGAGAGCTTCCAAAGCAAGGGGTTGAACGCTACTGATCTCGTCGCTCTGTCAG
GTGCTCACACGGTCGGCAAAGCCCACTGC
CCGACGTTCTCCGGCCGCTTGCGTCCATCGCTGGACCCCGACTTGGACATAAATTTCGCCCAAAAGCTGGCGGCGACTTGCCGGGAAGGCGACGACGACTTCGCGACCTCAAACTCCACG
GATCTCGACAGCTCCACTCCAAACCGATTCGACAACGCGTACTACAGGAACCTGTTGGGGAAGAAGGGGCTTCTCACCTCGGACCAGCAGCTGTTCGTGGACAATCGCACGAGCAGCCTG
GTGGAAGCGTTCGCGCGCAGCCAGCGCTCCTTCTTCTCGCAGTTTGCGGCGTCGTTCGTCAAGCTCAGCAAGATCCAAGTGCTCACTGGGAGCGAGGGGGAGGTCCGGATCAATTGCTCC
GTTGCCAATCCATCGCGAATGCTCTACGATGCTTGA

Retrieve as FASTA