Entry information : SmPrx50-2_101 (SmPrx50b_101)
Entry ID 7129
Creation 2009-11-12 (Paula Nunes)
Last sequence changes 2009-11-12 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx50-2_101 (SmPrx50b_101)
Name (synonym) SmPrx50-2_101 (SmPrx50b_101)
Class Class III peroxidase    [Orthogroup: Prx069]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx50-2_101
start..stop
S start..stop
SmPrx50-1_126 658 0 1..327 1..327
SmPrx74-2_39 458 7.19e-164 8..327 13..329
SmPrx74-1_88 457 3.37e-163 8..327 13..329
SmPrx36-2_44 405 2.63e-142 5..327 58..375
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7129' 'join(301386..301787,301867..302448)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 301386..301787 400 N° 2 301867..302448 580  
join(301386..301787,301867..302448)


exon

Literature and cross-references SmPrx50-2_101 (SmPrx50b_101)
DNA ref. Phytozome 12:   scaffold_101 (301386..302448)
Protein sequence: SmPrx50-2_101 (SmPrx50b_101)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   35273.04 (32817.6)  
PI (pH):   %s   8.96 (8.58) Peptide Signal:   %s   cut: 24 range:24-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTGMLLIVVFATLLVTQKPVTAQLSPLFYARSCPNLQALVRRVV
QQAVFQEPRMAASLLRLFFHDCFVQGCDASILLDDTSSFTGEKTAVPNRNSVRGFEVIDNIKSAVENACPRTVSC
ADILALAARESVLA
LQGPAWSVPLGRRDSTIASLASANNDIPAPTSTLSQLISKFQAKGLSIQDLVATSGAHTIGLARCVTFRDRLYNFSNTGAPDPNLNRFFLANLQQQCSPSTSSDNS
LSALDVRSPNRFDNSYFVNLQFNRGLLNSDQVLASTQNGVAQGLVSLYANRPFQFFRDFASAMVNMGNISPLTGSAGQIRTSCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 2). No EST. No prediction from JGI.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCGGGATGTTGCTGATCGTCGTTTTTGCCACACTCCTCGTCACCCAAAAGCCCGTCACTGCGCAGCTCAGTCCCTTGTTCTATGCTCGGAGCTGTCCCAATTTGCAAGCCTTG
GTGAGAAGAGTAGTCCAGCAAGCCGTCTTTCAAGAGCCCAGGATGGCCGCTTCGCTGCTTCGCCTGTTCTTCCACGACTGCTTCGTCCAAGGTTGCGATGCCTCCATCCTCCTGGACGAT
ACCTCGAGCTTCACCGGGGAGAAGACCGCAGTCCCGAACCGGAACTCCGTCCGAGGATTCGAAGTTATTGACAACATCAAGTCGGCGGTTGAGAATGCATGCCCGAGAACAGTCTCCTGT
GCTGATATCCTCGCTCTTGCAGCTCGCGAAAGCGTCCTAGCC
CCGTAAGCCACCATATCGCCTTTTCCTTGTTTCTTAACGATTCATCCTAAAAGTTTCTGTTGATCGCTTTGTCTCATA
TAGTTGCAAGGACCAGCATGGAGTGTTCCTCTGGGACGCCGAGACAGCACCATTGCAAGCCTCGCCTCAGCCAACAATGATATTCCAGCTCCAACTTCGACACTCTCACAGCTCATCTCA
AAGTTTCAGGCCAAGGGACTGTCGATCCAAGACTTGGTCGCAACCTCGGGTGCTCATACGATCGGGCTTGCTCGCTGCGTGACCTTCCGAGACCGTCTCTACAACTTCAGCAACACCGGA
GCTCCAGATCCAAATCTCAACAGGTTCTTCCTTGCAAACTTGCAGCAGCAGTGCAGCCCCTCGACTTCATCGGACAATAGCCTCTCCGCCCTCGATGTCAGGAGCCCGAATAGATTTGAC
AACTCGTACTTCGTCAACCTCCAATTCAACCGGGGACTTCTCAACTCGGACCAAGTTTTGGCATCCACGCAGAACGGTGTCGCTCAGGGGCTTGTAAGCTTGTATGCTAACAGGCCGTTT
CAGTTCTTCAGAGATTTTGCGTCGGCAATGGTCAACATGGGGAACATCAGTCCGCTCACGGGCAGTGCGGGACAAATCCGAACCAGCTGCCGCGTTGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGACCGGGATGTTGCTGATCGTCGTTTTTGCCACACTCCTCGTCACCCAAAAGCCCGTCACTGCGCAGCTCAGTCCCTTGTTCTATGCTCGGAGCTGTCCCAATTTGCAAGCCTTG
GTGAGAAGAGTAGTCCAGCAAGCCGTCTTTCAAGAGCCCAGGATGGCCGCTTCGCTGCTTCGCCTGTTCTTCCACGACTGCTTCGTCCAAGGTTGCGATGCCTCCATCCTCCTGGACGAT
ACCTCGAGCTTCACCGGGGAGAAGACCGCAGTCCCGAACCGGAACTCCGTCCGAGGATTCGAAGTTATTGACAACATCAAGTCGGCGGTTGAGAATGCATGCCCGAGAACAGTCTCCTGT
GCTGATATCCTCGCTCTTGCAGCTCGCGAAAGCGTCCTAGCC
TTGCAAGGACCAGCATGGAGTGTTCCTCTGGGACGCCGAGACAGCACCATTGCAAGCCTCGCCTCAGCCAACAATGAT
ATTCCAGCTCCAACTTCGACACTCTCACAGCTCATCTCAAAGTTTCAGGCCAAGGGACTGTCGATCCAAGACTTGGTCGCAACCTCGGGTGCTCATACGATCGGGCTTGCTCGCTGCGTG
ACCTTCCGAGACCGTCTCTACAACTTCAGCAACACCGGAGCTCCAGATCCAAATCTCAACAGGTTCTTCCTTGCAAACTTGCAGCAGCAGTGCAGCCCCTCGACTTCATCGGACAATAGC
CTCTCCGCCCTCGATGTCAGGAGCCCGAATAGATTTGACAACTCGTACTTCGTCAACCTCCAATTCAACCGGGGACTTCTCAACTCGGACCAAGTTTTGGCATCCACGCAGAACGGTGTC
GCTCAGGGGCTTGTAAGCTTGTATGCTAACAGGCCGTTTCAGTTCTTCAGAGATTTTGCGTCGGCAATGGTCAACATGGGGAACATCAGTCCGCTCACGGGCAGTGCGGGACAAATCCGA
ACCAGCTGCCGCGTTGTCAATTAA

Retrieve as FASTA