Entry information : SmPrx106-1_173 (SmPrx106a_173)
Entry ID 7130
Creation 2009-12-18 (Christophe Dunand)
Last sequence changes 2009-12-18 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-05-23 (Christophe Dunand)
Peroxidase information: SmPrx106-1_173 (SmPrx106a_173)
Name (synonym) SmPrx106-1_173 (SmPrx106a_173)
Class Class III peroxidase    [Orthogroup: Prx202]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx106-1_173
start..stop
S start..stop
SmPrx106-2_43 676 0 1..360 1..364
SmPrx15-1_0 399 7e-140 26..352 6..323
SmPrx15-2_60 399 9e-140 26..352 6..323
PtaPrx129 398 2e-139 54..354 34..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50244..50540 297 N° 2 49999..50190 192 N° 3 49743..49908 166 N° 4 49271..49674 404
N° 5 49010..49033 24  
complement(join(49010..49033,49271..49674,49743..49908,49999..50190,50244..50540 ))


exon

Literature and cross-references SmPrx106-1_173 (SmPrx106a_173)
DNA ref. Phytozome 12:   scaffold_173 (50540..49010)
mRNA ref. JGI transcript:   236822 [Incorrect prediction]
Protein sequence: SmPrx106-1_173 (SmPrx106a_173)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (318)
PWM (Da):   %s   39047.32 (34551.1) Transmb domain:   %s   o15-37i
PI (pH):   %s   4.86 (4.59) Peptide Signal:   %s   cut: 43 range:43-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMAPRSPPPPCFHCSFSFPSSSIAVFLFLAVLLLSICRSTSADDQQQQQQQELLVPGFYHSTCPQLQDIVQAGVEKAVENETRMAASLLRLHFHDCFVNGCDGSVLLDDTPTFTGEKNAVPNKNSIRGFEVIDQIKARVESECPGLVSCADIIAIAARDSVVLAGGPSWEVLLGRRDSLTASQAAANASIPSPALDVPALTKSFQNVGLTLQDMITLSGSHTIGQAHCFTFTQRLYNQSGNFQADPSMDSQFLLALKQLCPQGNPNPNTLASLDLSDPTVFNNHYFDNLMRGEGLLNSDQVLFTTTGITQEFVELFSKDQHAFFANFAISMVKMGNIKPLTGSEGEIRRDCRIFLNASD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns, extra intron 3'). Incorrect transcript prediction from JGI (short PS and long C-term). No ESTs. Prediction with FGENESH. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGCTCCTCGATCTCCTCCTCCTCCTTGCTTTCACTGTTCCTTCTCTTTTCCTTCCTCTTCGATCGCAGTGTTCTTGTTCCTGGCAGTGTTGCTTCTCTCGATTTGCAGAAGCACT
TCGGCAGATGATCAGCAGCAGCAGCAGCAGCAGGAGTTGCTCGTTCCCGGGTTTTACCACTCGACTTGTCCCCAGCTGCAAGACATTGTCCAAGCCGGCGTCGAGAAGGCTGTGGAGAAC
GAGACGAGAATGGCGGCCTCCCTGTTAAGGCTCCACTTCCACGACTGCTTTGTTAAC
GTGAGTTTCATGCGTAGAAGTCTCTTCTTCGTGAGCGAGCTTCGTTTCTGCAGGGTTGTGATG
GCTCGGTGCTGCTCGATGACACTCCCACTTTCACTGGCGAGAAGAATGCTGTCCCCAACAAAAACTCCATCCGAGGCTTCGAAGTGATCGACCAGATCAAAGCTCGTGTGGAGAGTGAGT
GCCCCGGACTAGTCTCCTGCGCTGATATCATCGCTATAGCTGCCAGAGACTCAGTAGTGCTG
GTAAGTAGTCACCTAATCTACTTTCTCAAAAGCACCACCTAAGTACCTGTTTCCACTC
TTTAATCTTTCTTCCTTTTCTCGATCGTGTAGGCTGGAGGTCCTTCGTGGGAAGTTCTTCTCGGACGGAGAGATAGCTTGACAGCAAGCCAGGCAGCAGCGAATGCGTCAATCCCTTCTC
CAGCTTTGGACGTTCCGGCATTGACGAAATCCTTCCAAAACGTTGGCCTGACACTGCAAGACATGATCACACTCTCAG
GTAAGTTCTCCACAACAAGAACAAAGAAACAAAACTTAGAAG
AGAAGCTTACCTTGATCACACTCCAGGCTCGCATACCATCGGCCAGGCTCACTGCTTCACGTTTACTCAGCGTCTCTACAACCAGAGTGGAAACTTTCAAGCCGATCCATCCATGGACTC
GCAGTTCCTGCTGGCTCTGAAGCAGCTCTGTCCGCAAGGAAATCCAAATCCCAACACTCTGGCCAGCCTCGACTTGAGCGATCCCACCGTCTTCAACAATCACTACTTCGACAATCTCAT
GCGCGGAGAGGGCCTCCTCAACTCGGACCAAGTCCTCTTCACCACCACCGGGATCACGCAAGAGTTCGTGGAGCTCTTTAGCAAGGACCAACACGCCTTCTTCGCGAACTTCGCCATCTC
CATGGTGAAGATGGGCAACATCAAGCCTCTCACTGGCAGCGAAGGAGAGATCCGTAGAGACTGCCGAGTC
GTGAATCCCAATCACGACATCTCTCCTTCTTCCCCTGTTCCTGTTCCTCC
AGAGACCGCGCTGCCACCGCCGCCACCACCGCCGCAAGACACCGGTGATCTCGCCGCTCCACCCCCGCCACAATTCCCCGAAGATCCTTCGTTCCAATTCCCTCCTTTTCCACCGTTCCC
GTTCTAAGCTAGCCAAGAACACTGTGTCGATAGTCAAATTCTTTCTTCTTGTGTGGAGTTGTGAAAGATTTTCCTCAATGCAAGCGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGGCTCCTCGATCTCCTCCTCCTCCTTGCTTTCACTGTTCCTTCTCTTTTCCTTCCTCTTCGATCGCAGTGTTCTTGTTCCTGGCAGTGTTGCTTCTCTCGATTTGCAGAAGCACT
TCGGCAGATGATCAGCAGCAGCAGCAGCAGCAGGAGTTGCTCGTTCCCGGGTTTTACCACTCGACTTGTCCCCAGCTGCAAGACATTGTCCAAGCCGGCGTCGAGAAGGCTGTGGAGAAC
GAGACGAGAATGGCGGCCTCCCTGTTAAGGCTCCACTTCCACGACTGCTTTGTTAAC
GGTTGTGATGGCTCGGTGCTGCTCGATGACACTCCCACTTTCACTGGCGAGAAGAATGCTGTC
CCCAACAAAAACTCCATCCGAGGCTTCGAAGTGATCGACCAGATCAAAGCTCGTGTGGAGAGTGAGTGCCCCGGACTAGTCTCCTGCGCTGATATCATCGCTATAGCTGCCAGAGACTCA
GTAGTGCTG
GCTGGAGGTCCTTCGTGGGAAGTTCTTCTCGGACGGAGAGATAGCTTGACAGCAAGCCAGGCAGCAGCGAATGCGTCAATCCCTTCTCCAGCTTTGGACGTTCCGGCATTG
ACGAAATCCTTCCAAAACGTTGGCCTGACACTGCAAGACATGATCACACTCTCAG
GCTCGCATACCATCGGCCAGGCTCACTGCTTCACGTTTACTCAGCGTCTCTACAACCAGAGTGGA
AACTTTCAAGCCGATCCATCCATGGACTCGCAGTTCCTGCTGGCTCTGAAGCAGCTCTGTCCGCAAGGAAATCCAAATCCCAACACTCTGGCCAGCCTCGACTTGAGCGATCCCACCGTC
TTCAACAATCACTACTTCGACAATCTCATGCGCGGAGAGGGCCTCCTCAACTCGGACCAAGTCCTCTTCACCACCACCGGGATCACGCAAGAGTTCGTGGAGCTCTTTAGCAAGGACCAA
CACGCCTTCTTCGCGAACTTCGCCATCTCCATGGTGAAGATGGGCAACATCAAGCCTCTCACTGGCAGCGAAGGAGAGATCCGTAGAGACTGCCGAGTC
ATTTTCCTCAATGCAAGCGAT
TGA

Retrieve as FASTA