Entry information : SmPrx106-2_43 (SmPrx106b_43)
Entry ID 7131
Creation 2009-11-17 (Christophe Dunand)
Last sequence changes 2014-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-05-23 (Christophe Dunand)
Peroxidase information: SmPrx106-2_43 (SmPrx106b_43)
Name (synonym) SmPrx106-2_43 (SmPrx106b_43)
Class Class III peroxidase    [Orthogroup: Prx207]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx106-2_43
start..stop
S start..stop
SmPrx106-1_173 687 0 1..364 1..360
SmPrx15-1_0 400 4e-140 30..356 6..323
SmPrx15-2_60 399 6e-140 30..356 6..323
PtaPrx129 399 1e-139 58..358 34..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1646359..1646667 309 N° 2 1646724..1646915 192 N° 3 1647006..1647171 166 N° 4 1647240..1647643 404
N° 5 1647881..1647904 24  
join(1646359..1646667,1646724..1646915,1647006..1647171,1647240..1647643,1647881 ..1647904)


exon

Literature and cross-references SmPrx106-2_43 (SmPrx106b_43)
DNA ref. Phytozome 12:   scaffold_43 (1646028..1647904)
Protein sequence: SmPrx106-2_43 (SmPrx106b_43)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (318)
PWM (Da):   %s   39592.64 (34565.1) Transmb domain:   %s   o20-42i
PI (pH):   %s   4.86 (4.59) Peptide Signal:   %s   cut: 47 range:47-364
Sequence 406
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAPRSPPPPPPPPCFHCSFSFPSFSIAVFLFLAVLLLSICRSTSADDQQQQQQQELLVPGFYHSTCPQLQDIVQAGVEKAVENETRMAASLLRLHFHDCFVNGCDGSVLLDDTPTFTGEKNAVPNKNSIRGFEVIDQIKARLESECPGLVSCADIIAIAARDSVVLAGGPSWEVLLGRRDSLTASQAAANASIPSPALDVPALTKSFQNVGLTLQDMITLSGSHTIGQAHCFTFTQRLYNQSGNFQADPSMDSQFLLALKQLCPQGNPNPNTLASLDLSDPTVFNNHYFDNLMRGEGLLNSDQVLFTTTGITQEFVELFSKDQHAFFANFAISMVKMGNIKPLTGSEGEIRRDCRVIFLNASD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns, extra intron 3'). No prediction from JGI. No ESTs. Prediction with FGENESH using protein similar prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGGCTCCTCGATCTCCTCCTCCTCCTCCTCCTCCTCCTTGCTTTCACTGTTCCTTCTCTTTTCCTTCCTTTTCGATCGCAGTGTTCTTGTTCCTGGCAGTGTTGCTTCTCTCGATTT
GCAGAAGCACTTCGGCAGATGATCAGCAGCAGCAGCAGCAGCAGGAGTTGCTCGTTCCCGGGTTTTACCACTCGACTTGTCCCCAGCTGCAAGACATTGTCCAAGCCGGCGTCGAGAAGG
CTGTGGAGAACGAGACGAGAATGGCGGCCTCCCTGTTAAGGCTCCACTTCCACGACTGCTTTGTTAAC
GTGAGTTTCATGCGTAGAAGTCTTCTCTTCTTCGTGAGCGAGCTTCGTTTCT
GCAGGGTTGTGATGGCTCGGTGCTGCTCGACGACACTCCCACTTTCACTGGCGAGAAGAATGCTGTCCCCAACAAAAACTCCATCCGAGGCTTCGAAGTGATCGACCAGATCAAAGCTCG
TCTGGAGAGTGAGTGCCCCGGACTAGTCTCCTGCGCTGATATCATCGCTATAGCTGCCAGAGACTCGGTAGTGCTG
GTAAGTAGTCACCTAATCTACTTTCTCAAAAGCACCACCTAAGT
ACCTGTTTCCACTCTTTAATCTTTCTTCCTTTTCTCGATCGTGTAGGCTGGAGGTCCTTCGTGGGAAGTTCTTCTCGGACGGAGAGATAGCTTGACAGCAAGCCAGGCAGCAGCGAATGC
GTCGATCCCTTCTCCAGCTTTGGACGTTCCGGCATTGACGAAATCCTTCCAAAACGTTGGCCTGACACTGCAAGACATGATCACACTCTCAG
GTAAGTTCTCCACAACAAGAACAAAGAA
ACAAAACTTAGAAGAGAAGCTTACCTTGATCACACTCCAGGCTCGCATACCATCGGCCAGGCTCACTGCTTCACGTTTACTCAGCGTCTCTACAACCAGAGTGGAAACTTTCAAGCCGAT
CCATCCATGGACTCGCAGTTCCTGCTGGCTCTGAAGCAGCTCTGTCCGCAAGGAAATCCAAATCCCAACACTCTGGCCAGCCTCGACTTGAGCGATCCCACCGTCTTCAACAATCACTAC
TTCGACAATCTCATGCGCGGAGAGGGCCTCCTCAACTCGGACCAAGTCCTCTTCACCACCACCGGGATCACGCAAGAGTTCGTGGAGCTCTTTAGCAAGGACCAACACGCCTTCTTCGCG
AACTTCGCCATCTCCATGGTGAAGATGGGCAACATCAAGCCTCTCACTGGCAGCGAAGGAGAGATCCGTAGAGACTGCCGAGTC
GTGAATCCCAATCACGACATCTCTCCTTCTTCCCCT
GTTCCTGTTCCTCCAGAGACCGCGCTGCTACCGCCGCCACCACCGCCGCAAGAAACCGGTGATCTCGCCGCTCCACCCCCGCCGCAATTCCCCGAAGATCCTTCGTTCCAATTCCCTCCT
TTTCCACCGTTCCCGTTCTAAGCTAGCCAAGAACACTGTGTCGATAGTCAAATTCTTTCTTCTTGTGTGGAGTTGTGAAAGATTTTCCTCAATGCAAGCGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGGCTCCTCGATCTCCTCCTCCTCCTCCTCCTCCTCCTTGCTTTCACTGTTCCTTCTCTTTTCCTTCCTTTTCGATCGCAGTGTTCTTGTTCCTGGCAGTGTTGCTTCTCTCGATTT
GCAGAAGCACTTCGGCAGATGATCAGCAGCAGCAGCAGCAGCAGGAGTTGCTCGTTCCCGGGTTTTACCACTCGACTTGTCCCCAGCTGCAAGACATTGTCCAAGCCGGCGTCGAGAAGG
CTGTGGAGAACGAGACGAGAATGGCGGCCTCCCTGTTAAGGCTCCACTTCCACGACTGCTTTGTTAAC
GGTTGTGATGGCTCGGTGCTGCTCGACGACACTCCCACTTTCACTGGCGAGA
AGAATGCTGTCCCCAACAAAAACTCCATCCGAGGCTTCGAAGTGATCGACCAGATCAAAGCTCGTCTGGAGAGTGAGTGCCCCGGACTAGTCTCCTGCGCTGATATCATCGCTATAGCTG
CCAGAGACTCGGTAGTGCTG
GCTGGAGGTCCTTCGTGGGAAGTTCTTCTCGGACGGAGAGATAGCTTGACAGCAAGCCAGGCAGCAGCGAATGCGTCGATCCCTTCTCCAGCTTTGGACG
TTCCGGCATTGACGAAATCCTTCCAAAACGTTGGCCTGACACTGCAAGACATGATCACACTCTCAG
GCTCGCATACCATCGGCCAGGCTCACTGCTTCACGTTTACTCAGCGTCTCTACA
ACCAGAGTGGAAACTTTCAAGCCGATCCATCCATGGACTCGCAGTTCCTGCTGGCTCTGAAGCAGCTCTGTCCGCAAGGAAATCCAAATCCCAACACTCTGGCCAGCCTCGACTTGAGCG
ATCCCACCGTCTTCAACAATCACTACTTCGACAATCTCATGCGCGGAGAGGGCCTCCTCAACTCGGACCAAGTCCTCTTCACCACCACCGGGATCACGCAAGAGTTCGTGGAGCTCTTTA
GCAAGGACCAACACGCCTTCTTCGCGAACTTCGCCATCTCCATGGTGAAGATGGGCAACATCAAGCCTCTCACTGGCAGCGAAGGAGAGATCCGTAGAGACTGCCGAGTC
ATTTTCCTCA
ATGCAAGCGATTGA

Retrieve as FASTA