Entry information : SmPrx39-1_51 (SmPrx39a_51)
Entry ID 7136
Creation 2009-11-24 (Paula Nunes)
Last sequence changes 2009-11-24 (Paula Nunes)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: SmPrx39-1_51 (SmPrx39a_51)
Name (synonym) SmPrx39-1_51 (SmPrx39a_51)
Class Class III peroxidase    [Orthogroup: Prx248]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx39-1_51
start..stop
S start..stop
SmPrx39-2_71 657 0 1..324 1..324
SmPrx40-2_71 386 1.41e-135 26..324 25..316
SmPrx40-1_51 385 2.24e-135 26..324 25..316
LminPrx76 280 1.09e-93 1..322 8..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7136' 'complement(join(933163..933566,933621..933786,933849..934040,934100..934312))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 934100..934312 211 N° 2 933849..934040 190 N° 3 933621..933786 164 N° 4 933163..933566 402
complement(join(933163..933566,933621..933786,933849..934040,934100..934312))


exon

Literature and cross-references SmPrx39-1_51 (SmPrx39a_51)
DNA ref. Phytozome 12:   scaffold_51 (934312..933163)
mRNA ref. JGI transcript:   115533 [Incorrect prediction]
Protein sequence: SmPrx39-1_51 (SmPrx39a_51)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   35577.68 (33005.3)  
PI (pH):   %s   6.7 (6.28) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKIFATLFLVIAITGHYHARASMLDRDFYNEDCPEFEMIVAAT
VQSFLNRDHTVPPGLLRLVFHDAFVG
GLDSSVMLNSSSGPDPPERDARPNLSLHGFEVIDAIKEQLEEVCPETVSCSDILALAARDAVALSGGPFWRLKFGRRDGRRSFFQGALKDLPSPFENTTALLKKFRNRGFSAEEMVVLQG
GGHSIGVGHCPFFRDRYSNFSGTAQPDPALNPTHAIFLKASCDPNGNAAVANDHGSAHLLDNHYFLNIQKGKGLFNSDQEFYSDSRTRKSIDKYAASSEKFYLDFIKAMEKMSELGVLTG
SHGSIRTHCAIAK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect transcript prediction from JGI: fusion of exons 1 and 2 of the SmPr40a and exons 3 and 4 of SmPrx39a. No ESTs. Missing 'c'. containing motif fhda.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTAAGATCTTTGCTACGCTGTTCTTGGTCATCGCGATCACTGGCCATTATCATGCAAGAGCGTCGATGCTGGATCGCGATTTCTACAATGAAGATTGCCCGGAGTTCGAGATG
ATCGTGGCAGCGACCGTGCAAAGCTTTCTCAACAGAGATCACACCGTCCCGCCGGGATTGCTCCGACTGGTCTTTCACGACGCATTCGTTGGC
GTAAGTGAAATCCTTTCTTGTTTCACG
AGAACTGGGATCGCGATCTTTGCTTTTGCCAGGGGGGCTCGATAGCTCGGTCATGCTCAATTCATCCAGCGGGCCAGATCCACCCGAGAGAGATGCGAGACCCAACTTGTCACTGCATGG
ATTCGAAGTGATCGATGCGATCAAGGAGCAGCTCGAGGAAGTTTGCCCCGAAACAGTGTCGTGCTCTGATATTCTGGCACTGGCAGCTCGCGACGCGGTCGCACTG
GTATGGATCGATTG
TTCTTGCGAGTCTGGGATAGCTTTTTCTTTTGACATGTGATGATCTAGAGAGTGGAGGACCATTCTGGAGGCTGAAATTCGGAAGACGCGACGGAAGGAGATCCTTCTTCCAGGGAGCGT
TGAAGGATCTGCCTAGCCCGTTTGAGAACACGACCGCGCTGCTCAAGAAATTCAGGAATCGGGGATTCTCTGCGGAGGAAATGGTGGTTCTCCAAG
GTATGCACATATGATGATCGATCC
ATAACTCTGGAGAACTTCTGGTCTGCGCAGGAGAGGAGGGCACAGCATCGGTGTTGGGCATTGCCCATTTTTCCGGGATCGCTACTCCAATTTCAGCGGGACTGCGCAGCCCGATCCCGC
GCTCAATCCCACGCACGCCATCTTCCTCAAGGCGAGCTGCGATCCCAATGGCAACGCCGCGGTGGCCAACGATCACGGCTCCGCGCATTTGCTCGACAATCACTACTTCCTCAACATCCA
AAAGGGCAAGGGCCTCTTCAACTCGGATCAAGAATTCTACTCGGACAGCCGCACCAGAAAATCGATCGACAAGTACGCCGCTTCCAGCGAGAAATTCTATCTCGACTTCATAAAGGCGAT
GGAAAAGATGTCGGAGCTGGGCGTGCTGACGGGCTCGCACGGCTCCATCCGGACGCACTGTGCCATTGCCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTAAGATCTTTGCTACGCTGTTCTTGGTCATCGCGATCACTGGCCATTATCATGCAAGAGCGTCGATGCTGGATCGCGATTTCTACAATGAAGATTGCCCGGAGTTCGAGATG
ATCGTGGCAGCGACCGTGCAAAGCTTTCTCAACAGAGATCACACCGTCCCGCCGGGATTGCTCCGACTGGTCTTTCACGACGCATTCGTTGGC
GGGCTCGATAGCTCGGTCATGCTCAAT
TCATCCAGCGGGCCAGATCCACCCGAGAGAGATGCGAGACCCAACTTGTCACTGCATGGATTCGAAGTGATCGATGCGATCAAGGAGCAGCTCGAGGAAGTTTGCCCCGAAACAGTGTCG
TGCTCTGATATTCTGGCACTGGCAGCTCGCGACGCGGTCGCACTG
AGTGGAGGACCATTCTGGAGGCTGAAATTCGGAAGACGCGACGGAAGGAGATCCTTCTTCCAGGGAGCGTTGAAG
GATCTGCCTAGCCCGTTTGAGAACACGACCGCGCTGCTCAAGAAATTCAGGAATCGGGGATTCTCTGCGGAGGAAATGGTGGTTCTCCAAG
GAGGAGGGCACAGCATCGGTGTTGGGCAT
TGCCCATTTTTCCGGGATCGCTACTCCAATTTCAGCGGGACTGCGCAGCCCGATCCCGCGCTCAATCCCACGCACGCCATCTTCCTCAAGGCGAGCTGCGATCCCAATGGCAACGCCGCG
GTGGCCAACGATCACGGCTCCGCGCATTTGCTCGACAATCACTACTTCCTCAACATCCAAAAGGGCAAGGGCCTCTTCAACTCGGATCAAGAATTCTACTCGGACAGCCGCACCAGAAAA
TCGATCGACAAGTACGCCGCTTCCAGCGAGAAATTCTATCTCGACTTCATAAAGGCGATGGAAAAGATGTCGGAGCTGGGCGTGCTGACGGGCTCGCACGGCTCCATCCGGACGCACTGT
GCCATTGCCAAGTAA

Retrieve as FASTA