Entry information : SmPrx41-1_51 (SmPrx41a_51)
Entry ID 7138
Creation 2009-11-20 (Paula Nunes)
Last sequence changes 2009-11-20 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx41-1_51 (SmPrx41a_51)
Name (synonym) SmPrx41-1_51 (SmPrx41a_51)
Class Class III peroxidase    [Orthogroup: Prx348]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx41-1_51
start..stop
S start..stop
SmPrx41-2_71 683 0 1..336 1..336
EglPrx94 269 4.15e-89 1..333 1..321
EgrPrx94 269 4.99e-89 1..333 1..321
MePrx118 265 2.33e-87 53..333 51..340
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7138' 'complement(join(936212..936588,936651..936810,936860..937039,937096..937389))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 937096..937389 292 N° 2 936860..937039 178 N° 3 936651..936810 158 N° 4 936212..936588 375
complement(join(936212..936588,936651..936810,936860..937039,937096..937389))


exon

Literature and cross-references SmPrx41-1_51 (SmPrx41a_51)
DNA ref. Phytozome 12:   scaffold_51 (937389..936212)
EST ref. GenBank:   FE480582.1 [5' end]  FE454692.1 [3' end]
Cluster/Prediction ref. UniGene:   Smo.3553 [3' end]  Smo.8148 [3' end]
Protein sequence: SmPrx41-1_51 (SmPrx41a_51)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (310)
PWM (Da):   %s   35958.71 (33211.0) Transmb domain:   %s   o10-27i
PI (pH):   %s   10.39 (10.34) Peptide Signal:   %s   cut: 27 range:27-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLLPSKRLLLLLFVIALLVLSGDAATKKKKVKKSKAKKVKAVT
PAPSAGGMSLTFYNNKCSSFAKTVSDEVAAAMKKDPTIAAGLLRMHFHDCWVR
GCDASVLLSGPNSERQAGPNLSLRGFQVIDTIKSKLERSCRGVVSCADILTQATRDAVVKAGGPSWDVPLGRKDGRVSSAAEVQLPAPSESTNSLISKFNAKQLSVSDLVALSGAHSFGF
GNCGFFQSRITSRDPTLNSTYAQELQRKCQTSASVANDPITQNTLDNQYYKNLQQRKGLFTSDEGLFFHPQTKPLVDTFASNPVAFAQQFRASMAKLITLPPFQSNTGGIRTVCSIAK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 5 ESTs (FE448814.1; FE441597.1, FE480581.1). No prediction from JGI.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGCTGCTGCCATCCAAGAGGCTCTTGTTGCTACTTTTCGTCATCGCATTGCTGGTTTTGAGTGGTGATGCGGCCACCAAGAAGAAGAAGGTCAAGAAATCTAAAGCGAAGAAG
GTGAAAGCTGTTACGCCAGCTCCATCCGCCGGTGGTATGAGCCTCACGTTCTACAACAACAAATGTAGCTCTTTCGCCAAGACTGTCAGTGATGAAGTGGCTGCTGCCATGAAGAAGGAT
CCCACCATCGCTGCCGGGCTCTTGAGGATGCACTTCCACGACTGCTGGGTTCGA
GTAAGTTCCTCCTGTGGGTTTTAGTGATGCTCGACACTTACCTCATAACTTGACAGGGGGATGCGA
TGCTTCGGTTCTTCTCAGTGGCCCAAACTCGGAGAGGCAAGCCGGGCCAAACCTCTCGCTCCGTGGATTCCAAGTCATTGACACCATCAAGAGCAAGCTCGAGAGGTCGTGCCGCGGAGT
CGTCTCTTGCGCTGATATCTTGACACAAGCAACGCGGGACGCAGTTGTCAAG
GTAAGAAACTTTCTCAAAAACTATTTTAGATTTAACCACTATAGTTTAGGCGCTGGAGGCCCATCGTG
GGATGTTCCACTGGGAAGGAAAGATGGACGAGTTTCCAGCGCTGCCGAGGTTCAGCTTCCTGCACCCTCCGAATCCACCAACTCATTGATCAGCAAATTCAATGCCAAGCAGCTCTCCGT
CTCGGACTTGGTGGCACTCTCAG
GTACTTCAAACTTCCTCTCGGATATCAGATGGTAACTTTGGATCTTGCTTGTGATCTCACAGGTGTGCTCACAGCTTTGGATTCGGAAACTGTGGCT
TCTTCCAGAGCAGGATCACGTCGCGAGACCCGACTCTCAACTCCACTTACGCGCAGGAGCTCCAGAGGAAATGCCAGACCAGTGCGTCGGTGGCCAACGATCCCATCACCCAGAACACGC
TCGACAACCAGTACTACAAGAACCTCCAGCAGAGGAAGGGGCTCTTCACCTCGGACGAGGGGCTGTTCTTCCACCCCCAGACTAAACCGCTCGTCGATACCTTTGCATCCAACCCGGTAG
CGTTCGCCCAGCAGTTTAGAGCCTCGATGGCGAAGTTGATCACTCTGCCACCTTTTCAGTCCAACACTGGTGGCATTCGAACCGTCTGCTCCATCGCCAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGCTGCTGCCATCCAAGAGGCTCTTGTTGCTACTTTTCGTCATCGCATTGCTGGTTTTGAGTGGTGATGCGGCCACCAAGAAGAAGAAGGTCAAGAAATCTAAAGCGAAGAAG
GTGAAAGCTGTTACGCCAGCTCCATCCGCCGGTGGTATGAGCCTCACGTTCTACAACAACAAATGTAGCTCTTTCGCCAAGACTGTCAGTGATGAAGTGGCTGCTGCCATGAAGAAGGAT
CCCACCATCGCTGCCGGGCTCTTGAGGATGCACTTCCACGACTGCTGGGTTCGA
GGATGCGATGCTTCGGTTCTTCTCAGTGGCCCAAACTCGGAGAGGCAAGCCGGGCCAAACCTCTCG
CTCCGTGGATTCCAAGTCATTGACACCATCAAGAGCAAGCTCGAGAGGTCGTGCCGCGGAGTCGTCTCTTGCGCTGATATCTTGACACAAGCAACGCGGGACGCAGTTGTCAAG
GCTGGA
GGCCCATCGTGGGATGTTCCACTGGGAAGGAAAGATGGACGAGTTTCCAGCGCTGCCGAGGTTCAGCTTCCTGCACCCTCCGAATCCACCAACTCATTGATCAGCAAATTCAATGCCAAG
CAGCTCTCCGTCTCGGACTTGGTGGCACTCTCAG
GTGCTCACAGCTTTGGATTCGGAAACTGTGGCTTCTTCCAGAGCAGGATCACGTCGCGAGACCCGACTCTCAACTCCACTTACGCG
CAGGAGCTCCAGAGGAAATGCCAGACCAGTGCGTCGGTGGCCAACGATCCCATCACCCAGAACACGCTCGACAACCAGTACTACAAGAACCTCCAGCAGAGGAAGGGGCTCTTCACCTCG
GACGAGGGGCTGTTCTTCCACCCCCAGACTAAACCGCTCGTCGATACCTTTGCATCCAACCCGGTAGCGTTCGCCCAGCAGTTTAGAGCCTCGATGGCGAAGTTGATCACTCTGCCACCT
TTTCAGTCCAACACTGGTGGCATTCGAACCGTCTGCTCCATCGCCAAGTGA

Retrieve as FASTA