Entry information : SmPrx39-2_71 (SmPrx39b_71)
Entry ID 7139
Creation 2009-11-18 (Paula Nunes)
Last sequence changes 2009-11-18 (Paula Nunes)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: SmPrx39-2_71 (SmPrx39b_71)
Name (synonym) SmPrx39-2_71 (SmPrx39b_71)
Class Class III peroxidase    [Orthogroup: Prx248]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx39-2_71
start..stop
S start..stop
SmPrx39-1_51 657 0 1..324 1..324
SmPrx40-2_71 385 2.19e-135 26..324 25..316
SmPrx40-1_51 385 5.67e-135 26..324 25..316
LminPrx76 278 1.02e-92 1..322 8..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7139' 'complement(join(144660..145063,145148..145313,145375..145566,145626..145838))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 145626..145838 211 N° 2 145375..145566 190 N° 3 145148..145313 164 N° 4 144660..145063 402
complement(join(144660..145063,145148..145313,145375..145566,145626..145838))


exon

Literature and cross-references SmPrx39-2_71 (SmPrx39b_71)
DNA ref. Phytozome 12:   scaffold_71 (145838..144660)
mRNA ref. JGI transcript:   123452 [Incorrect prediction]
Protein sequence: SmPrx39-2_71 (SmPrx39b_71)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (303)
PWM (Da):   %s   35479.64 (33129.4)  
PI (pH):   %s   6.51 (6.28) Peptide Signal:   %s   cut: 22 range:22-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKIFATLFLLIAITGQYHARASTLDGDFYNEDCPEFEMIVAAT
VQSFLNRDHTVPPGLLRLVFHDAFVG
GLDSSVMLNSSSGPDPPERDARPNLSLHGFEVIDAIKEQLEEICPETVSCSDILALAARDAVALSGGPFWRLKFGRRDGRRSFFQGALKDLPSPFENTTALLKKFRNRGFSAEEMVVLQG
GGHSIGVGHCPFFRDRYSNFSGTAQPDPALNPTHAIFLKASCDPNGNAAVPNDHGSAHLLDNHYFLNIQKGKGLFNSDQEFYSDSRTRKSIDKYAASSDKFYLDFIKAMEKMSELGVLTG
SHGSIRTHCAIAK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect transcript prediction from JGI: fusion of exons 1 and 2 of the SmPr41b, exon 3 of SmPrx40b and exon 4 of SmPrx39b. No ESTs. Missing 'c'. containing motif fhda.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTAAGATCTTTGCTACGCTGTTCTTGCTCATTGCGATCACTGGCCAATATCATGCAAGAGCGTCGACGCTGGATGGCGATTTCTACAACGAAGATTGCCCGGAGTTCGAGATG
ATCGTCGCAGCGACGGTGCAAAGCTTTCTCAACAGAGATCACACCGTCCCTCCGGGATTGCTCCGACTGGTCTTTCACGACGCATTCGTTGGC
GTAAGTAGAATCGACTCCATCTTATAA
TCTTCTTTCACGACGATCTTTGCTTTTGCCAGGGGGGCTCGATAGCTCGGTCATGCTCAATTCATCCAGCGGGCCAGATCCACCCGAGAGAGATGCGAGACCAAACTTGTCACTGCATGG
ATTCGAAGTGATCGATGCGATCAAGGAGCAGCTCGAGGAAATTTGCCCCGAAACAGTGTCGTGCTCTGATATTCTGGCGCTGGCAGCTCGCGATGCGGTCGCACTG
GTATGGATCGATTG
TTCTTGCGAGTCTGGGATAACTTTTCTTTTGGCATGTGATGATCTAGAGAGTGGAGGACCATTCTGGAGGCTGAAATTCGGAAGACGCGATGGAAGGAGATCCTTCTTCCAGGGAGCGTT
GAAGGATCTGCCTAGCCCGTTTGAGAACACGACCGCGCTGCTCAAGAAATTCAGGAATCGGGGATTCTCTGCGGAGGAAATGGTGGTTCTCCAAG
GTACGCACATATGATGATCGATCCA
ATGTTATCCAGTATATGCATAGTTGGTGCCTAACTCTGGAGAACTTCTGGTCTGCGCAGGAGAGGAGGGCACAGCATCGGTGTTGGGCATTGCCCATTTTTCCGGGATCGCTACTCCAAT
TTCAGCGGGACTGCGCAGCCCGATCCCGCGCTCAATCCCACGCACGCCATCTTCCTCAAGGCGAGCTGCGATCCCAATGGCAACGCCGCGGTGCCCAACGATCACGGCTCCGCGCATTTG
CTCGATAATCACTACTTCCTCAACATCCAAAAGGGCAAGGGCCTCTTCAACTCGGATCAAGAGTTCTACTCGGACAGCCGCACCAGAAAATCGATTGACAAGTACGCCGCTTCCAGCGAC
AAATTCTATCTCGACTTCATAAAGGCGATGGAAAAGATGTCGGAGCTGGGCGTGCTGACGGGCTCGCACGGCTCCATCCGGACGCACTGTGCCATTGCCAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTAAGATCTTTGCTACGCTGTTCTTGCTCATTGCGATCACTGGCCAATATCATGCAAGAGCGTCGACGCTGGATGGCGATTTCTACAACGAAGATTGCCCGGAGTTCGAGATG
ATCGTCGCAGCGACGGTGCAAAGCTTTCTCAACAGAGATCACACCGTCCCTCCGGGATTGCTCCGACTGGTCTTTCACGACGCATTCGTTGGC
GGGCTCGATAGCTCGGTCATGCTCAAT
TCATCCAGCGGGCCAGATCCACCCGAGAGAGATGCGAGACCAAACTTGTCACTGCATGGATTCGAAGTGATCGATGCGATCAAGGAGCAGCTCGAGGAAATTTGCCCCGAAACAGTGTCG
TGCTCTGATATTCTGGCGCTGGCAGCTCGCGATGCGGTCGCACTG
AGTGGAGGACCATTCTGGAGGCTGAAATTCGGAAGACGCGATGGAAGGAGATCCTTCTTCCAGGGAGCGTTGAAG
GATCTGCCTAGCCCGTTTGAGAACACGACCGCGCTGCTCAAGAAATTCAGGAATCGGGGATTCTCTGCGGAGGAAATGGTGGTTCTCCAAG
GAGGAGGGCACAGCATCGGTGTTGGGCAT
TGCCCATTTTTCCGGGATCGCTACTCCAATTTCAGCGGGACTGCGCAGCCCGATCCCGCGCTCAATCCCACGCACGCCATCTTCCTCAAGGCGAGCTGCGATCCCAATGGCAACGCCGCG
GTGCCCAACGATCACGGCTCCGCGCATTTGCTCGATAATCACTACTTCCTCAACATCCAAAAGGGCAAGGGCCTCTTCAACTCGGATCAAGAGTTCTACTCGGACAGCCGCACCAGAAAA
TCGATTGACAAGTACGCCGCTTCCAGCGACAAATTCTATCTCGACTTCATAAAGGCGATGGAAAAGATGTCGGAGCTGGGCGTGCTGACGGGCTCGCACGGCTCCATCCGGACGCACTGT
GCCATTGCCAAATAA

Retrieve as FASTA