Entry information : SmPrx[P]51b_1
Entry ID 7142
Creation 2010-01-22 (Christophe Dunand)
Last sequence changes 2010-01-22 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Toky Ramarohetra
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: SmPrx[P]51b_1
Name SmPrx[P]51b_1
Class Class III peroxidase     [Orthogroup: Prx006]*
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx[P]51b_1
start..stop
S start..stop
SmPrx[P]55b_1 463 4.71e-169 1..229 1..229
SmPrx[P]54b_1 463 4.71e-169 1..229 1..229
SmPrx[P]52b_1 437 9.3e-159 1..229 1..225
SmPrx[P]54a_16 436 6.53e-158 1..229 1..251
Gene structure Fichier Exons


exon

Literature and cross-references SmPrx[P]51b_1
DNA ref. Phytozome 12:   scaffold_1 (2617447..2618212)
mRNA ref. JGI transcript:   403456 [Incorrect prediction]
Protein sequence: SmPrx[P]51b_1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   24901.86  
PI (pH):   %s   8.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCDASILLDSKGSIKSERDSDKNFGIRRLDFIDRIKLMLEAACPGVVSCADIIVLVARESIVFTRGPTIPMLTGRRDSTAASNAAADRLLPPATVSVDNFISLFASKGLSLDESVAIIGA
HTIGVGHCVNIVNRLYPNQDSKISLLFASRLRVQCPTANPWMLNNITVINNDMTNLVFDNQYFRDLIARFSTNQQLFLNTFSSAFVKLTSSNVLTGQSGQVRKYCHSVN

Retrieve as FASTA  
Remarks Partial sequence from genomic (intron 3). No ESTs. No exon 1 predicted Missing sequence near FDN (last exon).
DNA
Send to BLAST
CDS
Send to BLAST