Entry information : SmAPx-Rb_8
Entry ID 7143
Creation 2009-12-18 (Christophe Dunand)
Last sequence changes 2011-03-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-06-14 (Christophe Dunand)
Peroxidase information: SmAPx-Rb_8
Name SmAPx-Rb_8
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmAPx-Rb_8
start..stop
S start..stop
SmAPx-Ra_0 613 0 1..305 1..305
GbAPx-R01 309 4.97e-105 34..287 87..341
ThasAPx-R01 308 3.8e-104 16..287 84..361
MenAPx-R01 298 2.47e-102 62..286 2..229
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7143' 'complement(join(2776713..2776772,2777043..2777112,2777166..2777235,2777313..2777434,2777523..2777606,2777675..2777771,2777841..2777883,2777942..2778015,2778074..2778195,2778263..2778347,2778407..2778497))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2778407..2778497 89 N° 2 2778263..2778347 83 N° 3 2778074..2778195 120 N° 4 2777942..2778015 72
N° 5 2777841..2777883 41 N° 6 2777675..2777771 95 N° 7 2777523..2777606 82 N° 8 2777313..2777434 120
N° 9 2777166..2777235 68 N° 10 2777043..2777112 68 N° 11 2776713..2776772 58  
complement(join(2776713..2776772,2777043..2777112,2777166..2777235,2777313..2777 434,2777523..2777606,2777675..2777771,2777841..2777883,2777942..2778015,2778074. .2778195,2778263..2778347,2778407..2778497))


exon

Literature and cross-references SmAPx-Rb_8
DNA ref. Phytozome 12:   scaffold_8 (2778497..2776713)
mRNA ref. JGI transcript:   408469
Protein sequence: SmAPx-Rb_8
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   305
PWM (Da):   %s   32947.91  
PI (pH):   %s   8.1
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMLLAWTSSVGALPKIDGGRCASCDCRDEARSPVVTRRFALLSSSSAALLSSKFALAVSEDAKDSRIREALRKVVSKQKAPGLLRLVFHDAGTFSASGGGMNGSIIYELERPENAGLER
SI
VLNKARGELEGSLHVSWADLIAVAGSEAIVICGGPFIPVKLGRLDSSVADIQGELPSEDLNAVALKKIFQSKGFSTQEMVALSGAHTLGSKGFGNPTVFDNSYYDVLLKMPWSDDNKM
ASMIGLPSDRVLVSDEECL
PWIQLYKRDQSKFYADFTLAYTKTWACKGQSYKTPDKFLDKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns). Splicing variant( => GSLHVSWADLIAVAGS is missing) confirmed with EST (FE442841.1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGCTACTCGCGTGGACGTCCTCCGTTGGCGCTCTTCCCAAGATCGATGGCGGCCGATGCGCTTCTTGCGATTGTCGAGACGAAGGTAACTTATATGCTTCTCCTGTTTCTTTT
ATTTCGAGCTTGGCTGTTCTTGTTTTGTAGCACAAGGAGTCCAGTGGTCACTAGGCGTTTTGCTCTTCTTTCCTCATCGTCGGCAGCCCTACTTAGCAGCAAGTTTGCTTTAGCAGTGTC
GGTGGCTTGCTTTTAAATCCTCGCTTCGTTCTTTGATGGATTTTTTTTTTCTCTCCTTGCGCAGAAAAGCGAGGATGCAAAAGACAGTCGCATTCGTGAAGCTCTGCGGAAAGTTGTGAG
CAAGCAAAAAGCTCCTGGTCTTTTGAGGCTCGTGTTTCATGATGCTGGGACTTTCAGCGCTTCCAAAG
GTAGAACGAGTTTCTTCTTCATCGCAAATGTCTAGACATCTTCTTTTATATC
ATTTAGGTGTGGTGGGATGAATGGATCTATCATTTACGAGCTGGAAAGACCAGAGAACGCGGGTCTCGAACGATCCATCAAGGTAATTGTAATGCTCATGTCAAGTTAGGCTAAACAAAT
ATGAGCACTCCTTTTCTTAGGTGTCCTCAACAAAGCTAGGGGGGAGTTAGAAGGTTCTCTTCATGGTACTGTTTATCATAGATTCTCGCCATGCTTTCGTGAATTAATTTTGCGTTATTT
TGATGTTTTTTAAGTGTGTCTTGGGCGGATCTTATTGCTGTTGCTGGGTCAGAAGCCATCGTTATCTGTGGAGGACCCTTCATTCCCGTGAAGTTAGGAAGACTGGACTCAAGGTTGGTG
TTGACTCTTTACTATGACCGGAAGACAGTGTATTGACCGTCTAGTTTATGTGTTGATCCAGTGTGTTGCTGACATACAAGGTGAGCTGCCTAGCGAGGATCTCAATGCTGTGGCCCTGAA
GAAGATTTTTCAAAGCAAGGGTTTCTC
GTGAGTATGTCTCGTCAAAGTTCGCTCGAACTTTTCATGCTTTTTTCTTATCACTTTCCTAATGGCTGCGACTTTGTCAAGCTTGTAGGAGAC
TCAAGAAATGGTAGCTCTTTCGGGCGCTCATACGCTTGGCAGCAAAGGTTTTGGCAATCCTACAGTGTTTGACAACAGCTATTACGACGTTCTCTTGAAGATGCCTTGGAGCGATCCTG
G
TAAGCTGACCAAGATCAAAGACTTTGACGGTGCATCCTTTCTTTCATTTTTTTCTTTGTTTTGTTTTGTTTTTCAGATATAACAAAATGGCGTCAATGATCGGCTTGCCATCTGATAGAG
TCCTTGTCAGTGACGAAGAGTGCCTCCC
GTAAGTCGCTGAATTTCGTTTTAGATGATACTGTTTATTTCTTCGACTTTCAGCTCTGGATACAACTTTACAAGCGGGACCAGTCGAAGTTC
TACGCCGATTTCACGTTGGCCTACACTAAGCTG
GTAAATCTAGGCGCGGAATGGGAAGGATAAAAGTCCCTGGTAATACAATAGAGAATGGTTTTCTTACTTCTTTGTTTTTTGGCTGCT
TCTTTGGCTCTCGTGTTCCCGGCGCAGCCACGTTGCATGTGGGGTGCTCAGAGGCCTCGCAAGAAAGCATATGGCGCTCTCAAATGCAACGAGGCAAAGATTGACGCAGACCATGAGTGG
TACGACTTTTATAAACCTCGTGCTTCGATTTCTTATGATATTTTCCTTGTCTTTTTAACACAGACACATGGGCCTGTAAAGGGCAAAGCTACAAAACTCCAGACAAATTTTTGGACAAAG
CTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGCTACTCGCGTGGACGTCCTCCGTTGGCGCTCTTCCCAAGATCGATGGCGGCCGATGCGCTTCTTGCGATTGTCGAGACGAAGCAAGGAGTCCAGTGGTCACTAGGCGTTTT
GCTCTTCTTTCCTCATCGTCGGCAGCCCTACTTAGCAGCAAGTTTGCTTTAGCAGT
AAGCGAGGATGCAAAAGACAGTCGCATTCGTGAAGCTCTGCGGAAAGTTGTGAGCAAGCAAAAA
GCTCCTGGTCTTTTGAGGCTCGTGTTTCATGATGCTGGGACTTTCAGCGCTTCCAAAG
GTGGTGGGATGAATGGATCTATCATTTACGAGCTGGAAAGACCAGAGAACGCGGGTCTCGAA
CGATCCATCAAG
GTCCTCAACAAAGCTAGGGGGGAGTTAGAAGGTTCTCTTCATGTGTCTTGGGCGGATCTTATTGCTGTTGCTGGGTCAGAAGCCATCGTTATCTGTGGAGGACCCTTC
ATTCCCGTGAAGTTAGGAAGACTGGACTCAAG
TGTTGCTGACATACAAGGTGAGCTGCCTAGCGAGGATCTCAATGCTGTGGCCCTGAAGAAGATTTTTCAAAGCAAGGGTTTCTCGACT
CAAGAAATGGTAGCTCTTTCGGGCGCTCATACGCTTGGCAGCAAAGGTTTTGGCAATCCTACAGTGTTTGACAACAGCTATTACGACGTTCTCTTGAAGATGCCTTGGAGCGATCCTG
AT
AACAAAATGGCGTCAATGATCGGCTTGCCATCTGATAGAGTCCTTGTCAGTGACGAAGAGTGCCTCCC
CTGGATACAACTTTACAAGCGGGACCAGTCGAAGTTCTACGCCGATTTCACG
TTGGCCTACACTAAGCTG
ACATGGGCCTGTAAAGGGCAAAGCTACAAAACTCCAGACAAATTTTTGGACAAAGCTTAA

Retrieve as FASTA