Entry information : SmAPx-Ra_0
Entry ID 7144
Creation 2009-12-18 (Christophe Dunand)
Last sequence changes 2011-06-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-06-14 (Christophe Dunand)
Peroxidase information: SmAPx-Ra_0
Name SmAPx-Ra_0
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmAPx-Ra_0
start..stop
S start..stop
SmAPx-Rb_8 613 0 1..305 1..305
GbAPx-R01 308 8.39e-105 34..287 87..341
ThasAPx-R01 308 3.41e-104 16..287 84..361
MenAPx-R01 299 1e-102 62..286 2..229
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7144' 'join(2716715..2716805,2716865..2716949,2717018..2717139,2717198..2717271,2717330..2717372,2717442..2717538,2717607..2717690,2717779..2717900,2717979..2718048,2718102..2718171,2718442..2718501)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2716715..2716805 89 N° 2 2716865..2716949 83 N° 3 2717018..2717139 120 N° 4 2717198..2717271 72
N° 5 2717330..2717372 41 N° 6 2717442..2717538 95 N° 7 2717607..2717690 82 N° 8 2717779..2717900 120
N° 9 2717979..2718048 68 N° 10 2718102..2718171 68 N° 11 2718442..2718501 58  
join(2716715..2716805,2716865..2716949,2717018..2717139,2717198..2717271,2717330 ..2717372,2717442..2717538,2717607..2717690,2717779..2717900,2717979..2718048,27 18102..2718171,2718442..2718501)


exon

Literature and cross-references SmAPx-Ra_0
DNA ref. Phytozome 12:   scaffold_0 (2716715..2718501)
mRNA ref. JGI transcript:   402404
Cluster/Prediction ref. UniGene:   Smo.5996
Protein sequence: SmAPx-Ra_0
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   305 (294)
PWM (Da):   %s   32888.91 (31819.2)  
PI (pH):   %s   8.56 (8.93) Peptide Signal:   %s   cut: 27 range:27-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMLLGWTSSVGALPKIDGGRCASCDCRDEARSPVVTRRFALISSSSAALLSSKFALAVSEDAKDSRIREALRKVVSKQKAPGLLRLVFHDAGTFSASGGGMNGSIIYELERPENAGLERSIVLNKARGELEGSLHVSWADLIAVAGSEA
IVICGGPFIPVKLGRLDS
SVADIQGELPSEDLNAVALKKIFQSKGFSTQEMVALSGAHTLGSKGFGNPTVFDNSYYDVLLKMPWSDDNKMASMIGLPSDRVLVSDKECLPWIQVYKRDQS
KFYTDFTLAYTK
TWACKGQSYKTPDKSLDKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGCTACTCGGGTGGACGTCCTCCGTTGGCGCTCTTCCCAAGATCGATGGCGGCCGATGCGCTTCTTGCGATTGTCGAGACGAAGAGGTAACTTATATGCTTCTCCTGTTTCTT
TTATTTCGAGCTTGGCTGTTCTTGTTTTGTAGCAAGGAGTCCAGTGGTCACTAGGCGTTTTGCTCTTATTTCCTCATCGTCGGCAGCCCTACTTAGCAGCAAGTTTGCTTTAGCAGTGTG
TCGGTGGCTTGCTTTTAAATCCTCGCTTCGTTCTTTGATGGAGAAATTTTTTTTTCTCCTTGCGCAGAAGCGAGGATGCAAAAGACAGTCGCATTCGTGAAGCTTTGCGGAAAGTTGTGA
GCAAGCAAAAAGCTCCTGGTCTTTTGAGGCTCGTGTTTCATGATGCTGGGACTTTCAGCGCTTCCAAAG
AGGTAAAACGAGTTTCTTCTTCATCGCAAATGTCTAGACATCTTCTTTTAT
ATCATTGAGGTGGTGGGATGAATGGATCTATCATTTACGAGCTGGAAAGACCAGAGAACGCGGGTCTCGAACGATCCATCAAGAGGTAATTGTAATGCACATATCAAGTTAGGCTAAAAA
AATATGAGCACTCCTTTTCTTAGGTCCTCAACAAAGCTAGGGGGGAGTTAGAAGGTTCTCTTCATGTGGTACTGTTTATCATAGATTCTCGCCATGCTTTCGTGAATTAATTTTGGATTA
TTTTGATGTTTTCTCAGTGTCTTGGGCGGATCTTATTGCTGTTGCTGGGTCAGAAGCCATCGTTATCTGTGGAGGACCCTTCATTCCCGTGAAGTTAGGAAGACTGGACTCAAGAGGTTG
GTGTTGACTCTTTACGATGACCGGAAGACAGTGTATTGACCGTCTAGTTTATGTGTTGATCCAGTGTTGCTGACATACAAGGTGAGCTGCCTAGCGAGGATCTCAATGCTGTGGCCCTGA
AGAAGATTTTTCAAAGCAAGGGTTTCTC
TCGTGAGTATGTCTCGTCAAAGTTCGCTCGAGCTTTTCATGCTTTTTTCTTATCACTTTCCTAATGGCTGCGACTTCGTCAAGCTTGTAGGA
CTCAAGAAATGGTAGCTCTTTCGGGCGCTCATACGCTTGGCAGCAAAGGTTTTGGCAATCCCACAGTGTTTGACAACAGCTATTACGACGTTCTCTTGAAGATGCCTTGGAGCGATCCTG
TGGTAAAGCTGACAAAGATCAAAGACTTTGACGGTGCATCCTTTCTTTCATTTTTTTCTTTGTTTTGTTTTGTTTTTCAGATAACAAAATGGCGTCAATGATCGGCTTGCCATCTGATAG
AGTCCTGGTCAGTGACAAAGAGTGCCTCCC
CCGTAAGTCGCTGAATTTCGTTTTAGATGATACTGTTTATTTCTTCGACTTTCAGCTGGATACAAGTATACAAGCGGGACCAGTCGAAGT
TCTACACTGATTTCACGTTGGCCTACACTAAGCTG
TGGTAAATCTAGGCGCGCAATGGGAAGGATAAAAGTCCCTGGTAATACAATAGAGAATGGTTTTCTTACTGCTTTGTTTTTTGGC
TGCCTCTTTGGCTCTCGTGTTCCCGGCGCAGCCACGTTGCATGTGGGGTGCTCAGAGGCCTCGCAAGAAAGCATATGGCGCTCTCAAGTGCAACGAGGCAAAGATTGACGCAGACCATGA
GTGGTACGACTTTTATAAATCTCGTGCTTCGATTTCTTATGATATTTTCCTTGTCTTTTTAACACAGACATGGGCCTGTAAAGGGCAAAGCTACAAAACTCCAGACAAATCTTTGGACAA
AGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGCTACTCGGGTGGACGTCCTCCGTTGGCGCTCTTCCCAAGATCGATGGCGGCCGATGCGCTTCTTGCGATTGTCGAGACGAAGCAAGGAGTCCAGTGGTCACTAGGCGTTTT
GCTCTTATTTCCTCATCGTCGGCAGCCCTACTTAGCAGCAAGTTTGCTTTAGCAGT
AAGCGAGGATGCAAAAGACAGTCGCATTCGTGAAGCTTTGCGGAAAGTTGTGAGCAAGCAAAAA
GCTCCTGGTCTTTTGAGGCTCGTGTTTCATGATGCTGGGACTTTCAGCGCTTCCAAAG
GTGGTGGGATGAATGGATCTATCATTTACGAGCTGGAAAGACCAGAGAACGCGGGTCTCGAA
CGATCCATCAAG
GTCCTCAACAAAGCTAGGGGGGAGTTAGAAGGTTCTCTTCATGTGTCTTGGGCGGATCTTATTGCTGTTGCTGGGTCAGAAGCCATCGTTATCTGTGGAGGACCCTTC
ATTCCCGTGAAGTTAGGAAGACTGGACTCAAG
TGTTGCTGACATACAAGGTGAGCTGCCTAGCGAGGATCTCAATGCTGTGGCCCTGAAGAAGATTTTTCAAAGCAAGGGTTTCTCGACT
CAAGAAATGGTAGCTCTTTCGGGCGCTCATACGCTTGGCAGCAAAGGTTTTGGCAATCCCACAGTGTTTGACAACAGCTATTACGACGTTCTCTTGAAGATGCCTTGGAGCGATCCTG
AT
AACAAAATGGCGTCAATGATCGGCTTGCCATCTGATAGAGTCCTGGTCAGTGACAAAGAGTGCCTCCC
CTGGATACAAGTATACAAGCGGGACCAGTCGAAGTTCTACACTGATTTCACG
TTGGCCTACACTAAGCTG
ACATGGGCCTGTAAAGGGCAAAGCTACAAAACTCCAGACAAATCTTTGGACAAAGCTTAA

Retrieve as FASTA