Entry information : BfuAPx-CcP01
Entry ID 7147
Creation 2010-01-10 (Marcel Zamocky)
Last sequence changes 2010-01-10 (Marcel Zamocky)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-26 (Christophe Dunand)
Peroxidase information: BfuAPx-CcP01
Name BfuAPx-CcP01
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Botryotinia
Organism Botryotinia fuckeliana (Botrytis cinerea Sclerotinia fuckeliana)    [TaxId: 40559 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BfuAPx-CcP01
start..stop
S start..stop
PmelaAPx-CcP01 523 0 1..514 1..517
ScocAPx-CcP01 429 2.67e-147 51..501 14..460
PmelaAPx-CcP02_FUNGUS 387 4.84e-130 32..505 32..520
HanAPx-CcP04 383 1.71e-128 34..482 34..490
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7147' 'complement(join(8833..10011,10074..10161,10213..10490))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10213..10490 276 N° 2 10074..10161 86 N° 3 8833..10011 1177  
complement(join(8833..10011,10074..10161,10213..10490))


exon

Literature and cross-references BfuAPx-CcP01
Protein ref. UniProtKB:   A6SQD3
DNA ref. JGI genome:   Supercontig_1.161 (10490..8833)
EST ref. GenBank:   EB802278.1 [5' end]
Protein sequence: BfuAPx-CcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   515 (494)
PWM (Da):   %s   53735.09 (51480.0)  
PI (pH):   %s   4.44 (4.39) Peptide Signal:   %s   cut: 22 range:22-515
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYQIFAIASIFSLGFLGVCHGQVTGIDVRDMMEEMEHIWVDNDGT
NSNGFVKGVSPCLNYALGSSNQGEQTSAQWVRFAFHDFVTANTTTGT
GGMDASLGFESTRGENHGLFVNDSLTFFKTVNAYLSMSDNIALAVVASVAKCGGSNSGIKLRVGRIDATSAGPAGVPGPATDLNTTLAQFAAAGFDASQTIGLTACGHSLGRVHNSDTPN
VVNSSFVTATNLDGGEPFDSTPGVLDPNNINDYLDGTGNRGGPLCTAANVADRSDYRLYISDNNATIQTMSEETAFQTKCNSLFEKMIEVVPSTVTLSDAVKPMEWKAVDVLMDISLRGD
VSISGLIRNLYTTTQPPKTVSYSTNSSTGNSSTGTSSETSGSGTSIFGSTTYWPFNSTIAPGTTSLSFNNVTYSVNDNIFVLPAQSSFDSSSGSVIVKSAALTSASGNGVMTAVLYVPTE
QEGTISPKIVQQNVTLTSYGTAGAYTLYSTDTVKISSTGTVIVKVAQGDSSSRTIKVTTFAP

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 1 EST. Strain="B05.10".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATCAAATTTTCGCGATAGCTTCTATTTTTTCCCTTGGGTTTTTGGGCGTATGCCATGGCCAAGTCACCGGCATAGACGTGAGGGATATGATGGAAGAAATGGAACATATTTGGGTC
GACAACGATGGGACCAATTCGAATGGTTTTGTGAAGGGTGTATCACCATGTCTGAATTATGCACTTGGATCTAGTAACCAAGGCGAGCAAACTTCCGCTCAATGGGTTCGATTCGCCTTT
CATGACTTTGTGACGGCAAACACTACTACTGGTACAGG
GTATGTCCTTTTAACTAAGATGTGTTAAGAGCGTTAGCTGACTTTTTGAAGTGTGGTATGGATGCATCACTAGGTTTTGAAA
GCACTCGCGGAGAAAATCATGGACTCTTCGTGAACGATTCTTTGACTTTCTTCAAGCCT
GTAAGATGAATCCAAAACCCCAGCCCAGTGTTCGTGTTTGGCAAGTACTGACCATTCAAAA
GACACAGTGAATGCGTATTTAAGCATGAGCGACAATATAGCTTTAGCAGTTGTCGCATCGGTTGCAAAATGCGGTGGTTCTAACTCGGGAATAAAATTACGCGTTGGCCGAATTGATGCA
ACGTCAGCAGGTCCAGCTGGTGTACCGGGACCGGCAACAGATTTAAACACAACTCTTGCTCAATTTGCAGCAGCTGGATTTGATGCCAGTCAAACCATCGGTCTAACAGCATGTGGACAT
TCATTGGGCCGTGTTCACAATTCTGATACTCCAAATGTTGTCAACTCTTCTTTTGTGACGGCAACCAATCTCGACGGAGGTGAGCCATTCGACTCGACTCCTGGTGTTTTGGATCCAAAT
AATATCAATGACTATTTGGATGGCACTGGAAATCGTGGAGGTCCTTTATGTACCGCGGCAAATGTGGCAGATCGATCAGATTATCGTCTATATATATCTGACAACAATGCAACCATCCAA
ACTATGTCAGAGGAGACAGCATTTCAAACGAAATGCAACTCGCTGTTTGAGAAAATGATAGAAGTTGTACCCAGTACAGTAACTCTCTCTGATGCAGTCAAGCCTATGGAATGGAAAGCA
GTGGACGTATTGATGGACATCTCCTTGCGTGGAGATGTTTCCATATCAGGACTTATTCGGAATCTTTACACTACTACTCAGCCTCCGAAAACTGTCTCTTATAGCACAAACTCTTCCACT
GGAAACTCTTCCACCGGCACAAGCAGTGAGACATCCGGTTCCGGGACGTCCATCTTCGGCTCGACTACCTATTGGCCGTTTAACAGCACGATTGCTCCGGGAACAACATCTTTGTCTTTC
AACAATGTGACTTATTCGGTCAATGACAATATCTTTGTCTTGCCGGCACAATCTTCCTTCGACTCAAGCAGTGGATCTGTCATTGTCAAAAGCGCTGCTCTAACATCTGCTAGTGGCAAT
GGGGTCATGACAGCTGTTTTGTATGTTCCCACTGAACAAGAAGGGACTATAAGTCCAAAGATTGTACAGCAAAACGTAACATTGACTTCATATGGTACCGCCGGGGCGTACACTCTGTAT
TCAACAGATACAGTAAAGATATCTTCCACTGGGACAGTAATTGTCAAAGTTGCTCAAGGTGATTCCTCGAGCCGAACTATCAAGGTTACCACATTTGCTCCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATCAAATTTTCGCGATAGCTTCTATTTTTTCCCTTGGGTTTTTGGGCGTATGCCATGGCCAAGTCACCGGCATAGACGTGAGGGATATGATGGAAGAAATGGAACATATTTGGGTC
GACAACGATGGGACCAATTCGAATGGTTTTGTGAAGGGTGTATCACCATGTCTGAATTATGCACTTGGATCTAGTAACCAAGGCGAGCAAACTTCCGCTCAATGGGTTCGATTCGCCTTT
CATGACTTTGTGACGGCAAACACTACTACTGGTACAGG
TGGTATGGATGCATCACTAGGTTTTGAAAGCACTCGCGGAGAAAATCATGGACTCTTCGTGAACGATTCTTTGACTTTCTTC
AAGCCT
ACAGTGAATGCGTATTTAAGCATGAGCGACAATATAGCTTTAGCAGTTGTCGCATCGGTTGCAAAATGCGGTGGTTCTAACTCGGGAATAAAATTACGCGTTGGCCGAATTGAT
GCAACGTCAGCAGGTCCAGCTGGTGTACCGGGACCGGCAACAGATTTAAACACAACTCTTGCTCAATTTGCAGCAGCTGGATTTGATGCCAGTCAAACCATCGGTCTAACAGCATGTGGA
CATTCATTGGGCCGTGTTCACAATTCTGATACTCCAAATGTTGTCAACTCTTCTTTTGTGACGGCAACCAATCTCGACGGAGGTGAGCCATTCGACTCGACTCCTGGTGTTTTGGATCCA
AATAATATCAATGACTATTTGGATGGCACTGGAAATCGTGGAGGTCCTTTATGTACCGCGGCAAATGTGGCAGATCGATCAGATTATCGTCTATATATATCTGACAACAATGCAACCATC
CAAACTATGTCAGAGGAGACAGCATTTCAAACGAAATGCAACTCGCTGTTTGAGAAAATGATAGAAGTTGTACCCAGTACAGTAACTCTCTCTGATGCAGTCAAGCCTATGGAATGGAAA
GCAGTGGACGTATTGATGGACATCTCCTTGCGTGGAGATGTTTCCATATCAGGACTTATTCGGAATCTTTACACTACTACTCAGCCTCCGAAAACTGTCTCTTATAGCACAAACTCTTCC
ACTGGAAACTCTTCCACCGGCACAAGCAGTGAGACATCCGGTTCCGGGACGTCCATCTTCGGCTCGACTACCTATTGGCCGTTTAACAGCACGATTGCTCCGGGAACAACATCTTTGTCT
TTCAACAATGTGACTTATTCGGTCAATGACAATATCTTTGTCTTGCCGGCACAATCTTCCTTCGACTCAAGCAGTGGATCTGTCATTGTCAAAAGCGCTGCTCTAACATCTGCTAGTGGC
AATGGGGTCATGACAGCTGTTTTGTATGTTCCCACTGAACAAGAAGGGACTATAAGTCCAAAGATTGTACAGCAAAACGTAACATTGACTTCATATGGTACCGCCGGGGCGTACACTCTG
TATTCAACAGATACAGTAAAGATATCTTCCACTGGGACAGTAATTGTCAAAGTTGCTCAAGGTGATTCCTCGAGCCGAACTATCAAGGTTACCACATTTGCTCCG

Retrieve as FASTA