Entry information : ZmPrx19
Entry ID 715
Creation 2005-12-14 (Christophe Dunand)
Last sequence changes 2005-12-14 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx19
Name ZmPrx19
Class Class III peroxidase    [Orthogroup: Prx147]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx19
start..stop
S start..stop
ZmPrx83 617 0 3..339 4..348
SiPrx12 617 0 1..339 1..344
SbPrx91 613 0 1..340 1..349
OsPrx54 546 0 32..340 36..345
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53617023..53617463 441 N° 2 53616751..53616916 166 N° 3 53616212..53616627 416  
complement(join(53616212..53616627,53616751..53616916,53617023..53617463))


exon

Literature and cross-references ZmPrx19
Literature Hainey,C.F. et al., unpublished
Protein ref. UniProtKB:   B4G1R4   B4FK24 [3' end]
DNA ref. GenBank:   AC191032.2 (90755..92003)
mRNA ref. GenBank:   BT043302
Protein sequence: ZmPrx19
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (313)
PWM (Da):   %s   36516.27 (33831.9) Transmb domain:   %s   i9-31o
PI (pH):   %s   6.83 (6.69) Peptide Signal:   %s   cut: 28 range:28-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARQQWSSGGLAVAVLAVLSSVLICSGHPVPGGLPLLPHFYGHACPQMEAIVGSLVAKAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDADGSGRFVTEKRSNPNKDSLRGFEVIDEIKAALEHACPHTVSCADIVAVAARDSVVLTGGPGWEVPLGRRDSLTASLSGSNNLIPAPNDSLPTIIGKFANQGLDIVDLVALSGGHTIGDSRCVSFRQRLYGQNNNGQVDRTLNPAYAAELRGRCPRSGGDQNLFALDLVTQFRFDNQYYHNILAMNGLLSSDEILLTQSRETMDLVHRYAADQGLFFDHFAKSMVKMGNISPLTGSAGEIRHNCRRVNHF

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 2 and 3) and 11 ESTs. ESTs from ZmPrx19 and 83 have been compile in the same unigene (Zm.2505). Cultivar="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGCCAACAGTGGAGCAGCGGCGGCCTCGCGGTCGCGGTGCTGGCCGTGCTGTCGTCCGTGCTCATCTGCTCGGGCCACCCGGTGCCGGGCGGGCTCCCCCTGCTGCCGCACTTC
TACGGCCACGCGTGCCCGCAGATGGAGGCCATCGTGGGGTCCCTCGTGGCGAAGGCGCACGCGGAGGACCCGCGCATGGCGGCGTCCCTGCTGCGGATGCACTTCCACGACTGCTTCGTG
CAGGGCTGCGACGCCTCCGTGCTGCTGGACGCCGACGGCAGCGGCAGGTTCGTCACCGAGAAACGGTCCAACCCCAACAAGGACTCGCTCCGGGGGTTCGAGGTCATCGACGAGATCAAG
GCCGCGCTCGAGCACGCCTGCCCGCACACCGTCTCCTGCGCCGACATCGTCGCCGTCGCCGCCAGGGACTCCGTCGTCCTG
GTACCCATCGATACGAACTGATGCAGCCTTGCAGCGTCG
TCTATACATTTACATTATCGTCACCCCGATCGTCGATGGTCTCGGTCGCCGATCGAGCTGCATGCAGACCGGCGGACCTGGCTGGGAGGTGCCACTGGGGAGGAGGGACTCGCTGACGGC
CAGCCTGAGCGGCTCCAACAACCTCATCCCTGCTCCCAACGACTCCCTCCCCACCATCATCGGCAAGTTCGCCAACCAAGGCCTCGACATCGTCGACCTCGTCGCACTCTCAG
GTACAGT
ACACAGTACACGTGCATGCGCGCGCGTTGGATCAGTTGCATTGCACTCCATCACATTTAGGAGTATACTGCGATAGTATACATATCCTTCCAACTGCAACGAACAACTGAACGCAGGGGG
GCACACCATCGGCGACTCGCGGTGCGTGAGCTTCCGGCAGCGGCTGTACGGCCAGAACAACAACGGGCAGGTGGACCGGACGCTGAACCCGGCGTACGCGGCGGAGCTGCGGGGCCGGTG
CCCGCGGTCGGGCGGCGACCAGAACCTGTTCGCGCTGGACCTGGTGACCCAGTTCCGGTTCGACAACCAGTACTACCACAACATCCTGGCCATGAACGGGCTGCTCAGCTCCGACGAGAT
CCTGCTCACGCAGAGCCGCGAGACCATGGACCTCGTCCACCGCTACGCCGCCGACCAGGGCCTCTTCTTCGACCACTTCGCCAAGTCCATGGTCAAGATGGGCAACATCTCGCCGCTCAC
CGGGAGCGCCGGCGAGATCAGGCACAACTGCAGGAGGGTCAACCACTTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGCCAACAGTGGAGCAGCGGCGGCCTCGCGGTCGCGGTGCTGGCCGTGCTGTCGTCCGTGCTCATCTGCTCGGGCCACCCGGTGCCGGGCGGGCTCCCCCTGCTGCCGCACTTC
TACGGCCACGCGTGCCCGCAGATGGAGGCCATCGTGGGGTCCCTCGTGGCGAAGGCGCACGCGGAGGACCCGCGCATGGCGGCGTCCCTGCTGCGGATGCACTTCCACGACTGCTTCGTG
CAGGGCTGCGACGCCTCCGTGCTGCTGGACGCCGACGGCAGCGGCAGGTTCGTCACCGAGAAACGGTCCAACCCCAACAAGGACTCGCTCCGGGGGTTCGAGGTCATCGACGAGATCAAG
GCCGCGCTCGAGCACGCCTGCCCGCACACCGTCTCCTGCGCCGACATCGTCGCCGTCGCCGCCAGGGACTCCGTCGTCCTG
ACCGGCGGACCTGGCTGGGAGGTGCCACTGGGGAGGAGG
GACTCGCTGACGGCCAGCCTGAGCGGCTCCAACAACCTCATCCCTGCTCCCAACGACTCCCTCCCCACCATCATCGGCAAGTTCGCCAACCAAGGCCTCGACATCGTCGACCTCGTCGCA
CTCTCAG
GGGGGCACACCATCGGCGACTCGCGGTGCGTGAGCTTCCGGCAGCGGCTGTACGGCCAGAACAACAACGGGCAGGTGGACCGGACGCTGAACCCGGCGTACGCGGCGGAGCTG
CGGGGCCGGTGCCCGCGGTCGGGCGGCGACCAGAACCTGTTCGCGCTGGACCTGGTGACCCAGTTCCGGTTCGACAACCAGTACTACCACAACATCCTGGCCATGAACGGGCTGCTCAGC
TCCGACGAGATCCTGCTCACGCAGAGCCGCGAGACCATGGACCTCGTCCACCGCTACGCCGCCGACCAGGGCCTCTTCTTCGACCACTTCGCCAAGTCCATGGTCAAGATGGGCAACATC
TCGCCGCTCACCGGGAGCGCCGGCGAGATCAGGCACAACTGCAGGAGGGTCAACCACTTCTAG

Retrieve as FASTA