Entry information : SmAPx01-2_8 (SmAPx01b_8)
Entry ID 7195
Creation 2010-02-09 (Christophe Dunand)
Last sequence changes 2010-02-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmAPx01-2_8 (SmAPx01b_8)
Name (synonym) SmAPx01-2_8 (SmAPx01b_8)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation Cytosolic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmAPx01-2_8
start..stop
S start..stop
SmAPx01-1_0 514 0 1..250 1..250
SstaAPx 512 0 1..250 1..250
SapAPx01 475 6.52e-173 1..250 1..250
SlAPx01 473 4.7e-172 1..250 1..250
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7195' 'join(3127159..3127243,3127314..3127347,3127420..3127594,3127732..3127797,3127873..3128007,3128068..3128147,3128203..3128305,3128367..3128441)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3127159..3127243 83 N° 2 3127314..3127347 32 N° 3 3127420..3127594 173 N° 4 3127732..3127797 64
N° 5 3127873..3128007 133 N° 6 3128068..3128147 78 N° 7 3128203..3128305 101 N° 8 3128367..3128441 73
join(3127159..3127243,3127314..3127347,3127420..3127594,3127732..3127797,3127873 ..3128007,3128068..3128147,3128203..3128305,3128367..3128441)


exon

Literature and cross-references SmAPx01-2_8 (SmAPx01b_8)
DNA ref. Phytozome 12:   scaffold_8 (3127159..3128441)
mRNA ref. JGI transcript:   144791
EST ref. GenBank:   FE456255.1
Protein sequence: SmAPx01-2_8 (SmAPx01b_8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27399.97  
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKSYPAVSEEYKAAVEKAKRKLRGFIAEKNCAPLILRLAWHSAGTYDCQSKTGGPFGTMKLAEELGHTANNGLDIAVKLLQPIKDQFPILSYGDFYLAGVVAVEVTGGPEIPFHPGRVD
KPTCPMEGRLPDATKGADHLRDVFVKHMGLTDKDIVALSGGHTL
GRAHKERSGFEGPWTHNPLQFDNSYFTILLSGEQEGILTLPTDKVLVEDPSFRPLVELYADEEAFFKDYTEAHLKL
SELGFAEE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns and 1 extra intron in 5'UTR) and ESTs (DN839337.1, FE434322.1, FE429588.1, FE456256.1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAATCTTACCCGGCCGTGAGCGAGGAGTACAAGGCCGCCGTGGAGAAGGCCAAGAGGAAGCTCCGCGGCTTCATCGCAGAGGCAAGATCGGCGGATCGAAGCTTGAAATTTCTA
GTCTTTCTGACCCTTTGTTTCCAATATTTTCTCGCAGAGAAGAACTGTGCGCCATTGATTCTCCGCCTTGCGCGTAAGTCTCTTGTCCTCTTTTTCTTTGGTTTCGCCTCTTCTTGTAAA
GCTCACGGCTCGCGTTGTGGAATAGATGGCACTCGGCGGGAACTTACGATTGCCAGTCCAAGACCGGTGGTCCTTTTGGCACCATGAAGCTCGCTGAGGAGCTTGGCCATACCGCGAACA
ATGGTCTCGACATCGCCGTGAAGCTGCTACAGCCAATCAAGGACCAGTTCCCCATCTTGAGCTATGGCGACTTCTATCAG
AGGTAAAGACTCGTCTTTGTTTGCTTTCCTTCGTTTGGTT
TTTCCCTTTAGTGCTGTGACGCTAGCTACCTCGAACGATAGTGTCTGGAATTAGTGCCATTTCGATAAGACTTGGTTCTTATAGATTATTTTTTTACAGCTTGCGGGAGTCGTTGCTGTG
GAAGTCACTGGTGGCCCCGAGATTCCATTCCATCCCGGGAGAGTG
TGGTGAGTTTTGATATTCGATTTTCAATTGGTTTCTCGTGGAATGATGTAACAAAAGAATGCCTTGGATGGATAC
AGGACAAGCCAACATGCCCAATGGAGGGACGGCTTCCAGATGCTACCAAGGGCGCGGATCATCTCAGAGACGTGTTTGTGAAGCATATGGGTCTCACGGACAAGGACATCGTGGCTCTTT
CTGGCGGTCACACTCTG
TGGTAAGCTGTATCAGTCTCAGAGAAAAAAAAATCTTACGAAACTTCGGTGTGTTTGTCCAGGGAAGAGCACACAAGGAACGATCCGGGTTTGAGGGCCCATG
GACGCACAACCCTCTCCAGTTTGACAACTCCTACTTCAC
ACGTAAGTCGATCGATTTCACTTTTCTTTCTTTCCGATCTAATCGTGTTTGCTCCAGGATACTGCTGAGCGGTGAGCAGGA
AGGCATCCTCACTCTCCCAACCGACAAAGTTCTCGTGGAGGATCCCTCATTCCGCCCGCTCGTGGAGCTCTACGCCAAG
AGGTAAAGAGAAATCTCCGCTTAGAACTCTGCGTGATCAAG
AGATAAATCTCACTTGGAACAGGACGAGGAGGCGTTCTTCAAGGACTACACCGAAGCCCACCTCAAGCTCTCGGAGCTTGGATTCGCCGAGGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAATCTTACCCGGCCGTGAGCGAGGAGTACAAGGCCGCCGTGGAGAAGGCCAAGAGGAAGCTCCGCGGCTTCATCGCAGAGAAGAACTGTGCGCCATTGATTCTCCGCCTTGCA
TGGCACTCGGCGGGAACTTACGATTGCCAGTCCAAGACCGGTGGTCCTTTTGGCACCATGAAGCTCGCTGAGGAGCTTGGCCATACCGCGAACAATGGTCTCGACATCGCCGTGAAGCTG
CTACAGCCAATCAAGGACCAGTTCCCCATCTTGAGCTATGGCGACTTCTATCAG
CTTGCGGGAGTCGTTGCTGTGGAAGTCACTGGTGGCCCCGAGATTCCATTCCATCCCGGGAGAGTG
GACAAGCCAACATGCCCAATGGAGGGACGGCTTCCAGATGCTACCAAGGGCGCGGATCATCTCAGAGACGTGTTTGTGAAGCATATGGGTCTCACGGACAAGGACATCGTGGCTCTTTCT
GGCGGTCACACTCTG
GGAAGAGCACACAAGGAACGATCCGGGTTTGAGGGCCCATGGACGCACAACCCTCTCCAGTTTGACAACTCCTACTTCACGATACTGCTGAGCGGTGAGCAGGAA
GGCATCCTCACTCTCCCAACCGACAAAGTTCTCGTGGAGGATCCCTCATTCCGCCCGCTCGTGGAGCTCTACGCCAAG
GACGAGGAGGCGTTCTTCAAGGACTACACCGAAGCCCACCTC
AAGCTCTCGGAGCTTGGATTCGCCGAGGAGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAAT CTTACCCGGC CGTGAGCGAG GAGTACAAGG CCGCCGTGGA GAAGGCCAAG AGGAAGCTCC GCGGCTTCAT CGCAGAGAAG AACTGTGCGC CATTGATTCT CCGCCTTGCA  TGGCACTCGG CGGGAACTTA CGATTGCCAG TCCAAGACCG GTGGTCCTTT TGGCACCATG AAGCTCGCTG AGGAGCTTGG CCATACCGCG AACAATGGTC TCGACATCGC CGTGAAGCTG  CTACAGCCAA TCAAGGACCA GTTCCCCATC TTGAGCTATG GCGACTTCTA TCAGCTTGCG GGAGTCGTTG CTGTGGAAGT CACTGGTGGC CCCGAGATTC CATTCCATCC CGGGAGAGTG  GACAAGCCAA CATGCCCAAT GGAGGGACGG CTTCCAGATG CTACCAAGGG CGCGGATCAT CTCAGAGACG TGTTTGTGAA GCATATGGGT CTCACGGACA AGGACATCGT GGCTCTTTCT  GGCGGTCACA CTCTGGGAAG AGCACACAAG GAACGATCCG GGTTTGAGGG CCCATGGACG CACAACCCTC TCCAGTTTGA CAACTCCTAC TTCACGATAC TGCTGAGCGG TGAGCAGGAA  GGCATCCTCA CTCTCCCAAC CGACAAAGTT CTCGTGGAGG ATCCCTCATT CCGCCCGCTC GTGGAGCTCT ACGCCAAGGA CGAGGAGGCG TTCTTCAAGG ACTACACCGA AGCCCACCTC 
AAGCTCTCGG AGCTTGGATT CGCCGAGGAG TAA 

Retrieve as FASTA