Entry information : SmAPx02-1_0 (SmAPx02a_0)
Entry ID 7196
Creation 2010-02-09 (Christophe Dunand)
Last sequence changes 2010-02-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmAPx02-1_0 (SmAPx02a_0)
Name (synonym) SmAPx02-1_0 (SmAPx02a_0)
Class Ascorbate peroxidase    [Orthogroup: APx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmAPx02-1_0
start..stop
S start..stop
SmAPx02-2_60 612 0 1..299 1..299
PpaAPx03 457 3.62e-164 1..295 1..297
AfiliAPx01 446 4.69e-160 1..299 1..290
SpraAPx03 444 3.52e-159 1..299 1..302
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7196' 'join(1354208..1354320,1354371..1354495,1354546..1354595,1354659..1354724,1354782..1354830,1354898..1354980,1355045..1355124,1355187..1355289,1355364..1355594)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1354208..1354320 111 N° 2 1354371..1354495 123 N° 3 1354546..1354595 48 N° 4 1354659..1354724 64
N° 5 1354782..1354830 47 N° 6 1354898..1354980 81 N° 7 1355045..1355124 78 N° 8 1355187..1355289 101
N° 9 1355364..1355594 229  
join(1354208..1354320,1354371..1354495,1354546..1354595,1354659..1354724,1354782 ..1354830,1354898..1354980,1355045..1355124,1355187..1355289,1355364..1355594)


exon

Literature and cross-references SmAPx02-1_0 (SmAPx02a_0)
DNA ref. Phytozome 12:   scaffold_0 (1354208..1355594)
mRNA ref. JGI transcript:   139337
EST ref. GenBank:   FE499277.1 [5' end]  FE475492.1 [3' end]
Cluster/Prediction ref. UniGene:   Smo.4450
Protein sequence: SmAPx02-1_0 (SmAPx02a_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   299 (298)
PWM (Da):   %s   32496.62 (32448.3) Transmb domain:   %s   o268-290i
PI (pH):   %s   7.11 (7.92) Peptide Signal:   %s   cut: 23 range:23-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPVPVVDNAYLKAIESARRDLRAFIAEKNCAPLMLRLAWHDAGTYDAVSKTGGPNGSIRSEREYTHAANNGLKIAIDFEPIKEKHPTITYADLYLAGVVAVEVTGGPTIDFVPGRKDSVATTPEGRLPDAHLGAKHIRDVFFRMGLSDKDIVALSGG
HT
GRGHKERSGFEGPWTPQPLKFDNSYFKELLRGESEGLLQLPTDKCLLEDPSFRPYVDLYADEDAFFKDYAESHKKLSELGCKHTSPAFGNAKASPAVDSHASTATVLAHSAFGLAVSA
IVVVLSYAYEVRRKTALK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and 13 ESTs. ESTs from two varaiants are compiled in the same unigene
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTGCCCGTCGTCGACAATGCGTACCTCAAGGCGATCGAATCCGCCAGGCGCGATCTCCGAGCTTTCATCGCCGAGAAGAATTGCGCGCCTCTGATGCTGCGATTGGCGCGTAAG
TTTCCACTCTTGATTCCAGCTCCTCTTGATTTCTAGCTCTCTCAGATGGCACGATGCTGGCACTTACGATGCCGTGTCCAAGACTGGAGGACCGAATGGCTCGATCCGGAGCGAGCGGGA
GTACACTCACGCTGCCAACAATGGGCTCAAAATTGCCATTGATTTCTGTG
TGGTGAGTGCTACTTTTTGGAGATTATATGCTATAGAAACATTGTTTCGCAGAGCCTATCAAGGAGAAAC
ACCCGACTATCACTTACGCGGATCTCTACCAG
AGGTGCATGGATTTTCTTTTTTCTTTTTGTGGTAATGGTCAATTTTAATTTTTCTCGCTTATCAGCTAGCTGGAGTTGTGGCTGTAGA
GGTAACTGGAGGACCTACGATCGATTTTGTGCCTGGCCGAAAG
AGGTTTCGTTTCTGTTTGAGCTCTTTTTGATCAGTAGAAAACATGAAACTTGTCCATAGGATTCCGTCGCTACTACA
CCAGAAGGACGACTTCCCGATGCTCATCTAG
AGGTTTGTATCATTCATTCTATGTAGCTATGAGTTTACAAGCTCGGGATGGCTGTTTTTTTTTTTTCAGGGGCAAAACATATCCGTGAC
GTGTTCTTTAGAATGGGTCTTTCTGACAAAGATATCGTCGCCCTCTCGGGAGGCCACACAATA
TAGTAAGTCTCTCCTGTTTTATAGAACAATAAAAGTTTGTTTTTTCTTTTTCTTCTT
TTTTTTCAGGGAAGAGGCCACAAGGAGAGATCCGGCTTTGAGGGACCATGGACACCACAGCCATTGAAGTTCGACAATTCGTACTTCAAAAGTAAGTCTCAGCTCTTTACTCTCTTTTTT
TGGTGTCTTACGTATAGTCCGAACAAACACTAGAGAGCTCTTGAGAGGAGAATCAGAGGGCCTCTTGCAGCTGCCAACAGACAAGTGTTTGCTCGAGGATCCGTCCTTCCGTCCATACGT
GGACTTGTATGCAAAG
AGGTATCGTCAAAAAAACAAAAGCTTTTGGAAGTTTTCTGAGACTCACTCACTATGACGATACTGTGATGATCCAGGACGAGGACGCATTCTTCAAAGATTACG
CCGAGTCTCACAAGAAACTCTCGGAGCTGGGATGCAAGCACACCTCTCCAGCGTTTGGAAACGCAAAGGCATCGCCAGCTGTGGATTCTCACGCGAGCACTGCGACAGTACTGGCTCACA
GTGCGTTTGGCCTCGCGGTTTCAGCCATCGTCGTCGTTCTCAGCTACGCTTACGAGGTTCGCAGGAAGACTGCTCTCAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTGCCCGTCGTCGACAATGCGTACCTCAAGGCGATCGAATCCGCCAGGCGCGATCTCCGAGCTTTCATCGCCGAGAAGAATTGCGCGCCTCTGATGCTGCGATTGGCATGGCAC
GATGCTGGCACTTACGATGCCGTGTCCAAGACTGGAGGACCGAATGGCTCGATCCGGAGCGAGCGGGAGTACACTCACGCTGCCAACAATGGGCTCAAAATTGCCATTGATTTCTGTG
AG
CCTATCAAGGAGAAACACCCGACTATCACTTACGCGGATCTCTACCAG
CTAGCTGGAGTTGTGGCTGTAGAGGTAACTGGAGGACCTACGATCGATTTTGTGCCTGGCCGAAAGGATTCC
GTCGCTACTACACCAGAAGGACGACTTCCCGATGCTCATCTAG
GGGCAAAACATATCCGTGACGTGTTCTTTAGAATGGGTCTTTCTGACAAAGATATCGTCGCCCTCTCGGGAGGCCAC
ACAATA
GGAAGAGGCCACAAGGAGAGATCCGGCTTTGAGGGACCATGGACACCACAGCCATTGAAGTTCGACAATTCGTACTTCAAAGAGCTCTTGAGAGGAGAATCAGAGGGCCTCTTG
CAGCTGCCAACAGACAAGTGTTTGCTCGAGGATCCGTCCTTCCGTCCATACGTGGACTTGTATGCAAAG
GACGAGGACGCATTCTTCAAAGATTACGCCGAGTCTCACAAGAAACTCTCG
GAGCTGGGATGCAAGCACACCTCTCCAGCGTTTGGAAACGCAAAGGCATCGCCAGCTGTGGATTCTCACGCGAGCACTGCGACAGTACTGGCTCACAGTGCGTTTGGCCTCGCGGTTTCA
GCCATCGTCGTCGTTCTCAGCTACGCTTACGAGGTTCGCAGGAAGACTGCTCTCAAGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGTGC CCGTCGTCGA CAATGCGTAC CTCAAGGCGA TCGAATCCGC CAGGCGCGAT CTCCGAGCTT TCATCGCCGA GAAGAATTGC GCGCCTCTGA TGCTGCGATT GGCATGGCAC  GATGCTGGCA CTTACGATGC CGTGTCCAAG ACTGGAGGAC CGAATGGCTC GATCCGGAGC GAGCGGGAGT ACACTCACGC TGCCAACAAT GGGCTCAAAA TTGCCATTGA TTTCTGTGAG  CCTATCAAGG AGAAACACCC GACTATCACT TACGCGGATC TCTACCAGCT AGCTGGAGTT GTGGCTGTAG AGGTAACTGG AGGACCTACG ATCGATTTTG TGCCTGGCCG AAAGGATTCC  GTCGCTACTA CACCAGAAGG ACGACTTCCC GATGCTCATC TAGGGGCAAA ACATATCCGT GACGTGTTCT TTAGAATGGG TCTTTCTGAC AAAGATATCG TCGCCCTCTC GGGAGGCCAC  ACAATAGGAA GAGGCCACAA GGAGAGATCC GGCTTTGAGG GACCATGGAC ACCACAGCCA TTGAAGTTCG ACAATTCGTA CTTCAAAGAG CTCTTGAGAG GAGAATCAGA GGGCCTCTTG  CAGCTGCCAA CAGACAAGTG TTTGCTCGAG GATCCGTCCT TCCGTCCATA CGTGGACTTG TATGCAAAGG ACGAGGACGC ATTCTTCAAA GATTACGCCG AGTCTCACAA GAAACTCTCG  GAGCTGGGAT GCAAGCACAC CTCTCCAGCG TTTGGAAACG CAAAGGCATC GCCAGCTGTG GATTCTCACG CGAGCACTGC GACAGTACTG GCTCACAGTG CGTTTGGCCT CGCGGTTTCA 
GCCATCGTCG TCGTTCTCAG CTACGCTTAC GAGGTTCGCA GGAAGACTGC TCTCAAGTAG 

Retrieve as FASTA