Entry information : PpaAPx[P]04 (PP00152G00470)
Entry ID 7197
Creation 2010-02-10 (Christophe Dunand)
Last sequence changes 2010-02-10 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang Li)
Peroxidase information: PpaAPx[P]04 (PP00152G00470)
Name (synonym) PpaAPx[P]04 (PP00152G00470)
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaAPx[P]04
start..stop
S start..stop
PpaAPx01 454 2.28e-165 1..222 25..246
CpuAPx01 428 5.89e-155 1..222 25..246
AangAPx02 419 2.42e-151 1..222 25..246
AangAPx03 414 3.48e-149 1..222 25..246
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7197' 'join(461742..461788,461980..462154,462342..462407,462659..462707,462923..463008,463166..463245,463367..463469,463656..463718)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 461742..461788 45 N° 2 461980..462154 173 N° 3 462342..462407 64 N° 4 462659..462707 47
N° 5 462923..463008 84 N° 6 463166..463245 78 N° 7 463367..463469 101 N° 8 463656..463718 61
join(461742..461788,461980..462154,462342..462407,462659..462707,462923..463008, 463166..463245,463367..463469,463656..463718)


exon

Literature and cross-references PpaAPx[P]04 (PP00152G00470)
DNA ref. Phytozome 12:   scaffold_152 (461742..463718)
Protein sequence: PpaAPx[P]04 (PP00152G00470)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222 (299)
PWM (Da):   %s   24315.22 (30946.8)  
PI (pH):   %s   4.99 (6.50) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGFADKNCAPIILRLAWHGSGTYDQESKTGGPLGTIRFGQELAHG
ANAGLDIAVNLLQPIKEQFPELSYADFY
LAGVVAVEVTGGPTIPFHPGRKDHETCPVEGRLPDATKGLDHLRCVFTKQMGLTDKDIVVLSGAHTGRCHKDRSGFEGAWTPNPLRFDNSYFQVLLEGEKDGLIM
LPSDKALLDEPKTRELVELYA
DEDKFFEDYAESHMKLSELG*

Retrieve as FASTA  
Remarks Partial sequence from genomic (7 introns). First exon is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTGGATTTGCAGATAAGAACTGTGCACCCATCATCCTTCGTCTCGCGCGTAAGTTGGTGACGCTTTGCATATTTGGGTGGTGGAGTGAATGTCCAATTTGTGCCGTGTGAAAAGTGGTC
CAGTTATGATGGGATGTTGAGAATTCGGAGCAGAATGCCATTTAGAGGGAGCGCAGCGGCGGGTGGAAATGGGGGATGGAATGTTAGTGATGAGTGAGGGTCGATTTGTGATTGTGACAG

ATGGCACGGGTCGGGAACTTACGATCAGGAGTCGAAGACAGGAGGTCCTCTTGGAACCATCCGGTTCGGGCAGGAGCTTGCGCACGGCGCCAACGCGGGGCTGGACATTGCAGTGAATCT
GCTGCAGCCCATCAAGGAGCAGTTTCCGGAGTTGTCGTACGCTGACTTTTACACG
CGGTAATGAATAAGAAGCGGGTTTGACGATGGGTGGGGCCAAGTAGGCTAGGTGGTTGCAGCAGC
GTTATTGGGGGGGGGGGGTTGCAGGCACTGCAATGAGTGAGGAGGTGGGGAGCTCCAGGAATAGGTGTTGGGATTGGAGTGGGAAGAAGGTTGGATTCTAAGGTTTGATGTCATGCGGTT
GCAGCTGGCTGGAGTCGTTGCCGTGGAGGTGACAGGCGGGCCCACCATTCCTTTTCACCCTGGGCGCAAGAGGTAAGAGCCTGGCTGGGCATTCGGGGAGAAGTGCGAGTTTTGGTGGTT
GCTCCCGAATGCGGGATTCGTGAAGCTGTGATGTTGTGAGAAGCAGGGGAAGTGGCGATTGGGGAGTGAGTCTTGAAGGGTTCTGACGTAGACGTGTGGGATGCGGGTGGAAGTGAGAAG
GTGGGGACAGCGTGGGATGGTTGAGAGCGAAGCGGGACTTAATACTGATGTCCGAGTGTGGTGAATGTGGTGTGTGTGTGCAGGATCATGAGACATGCCCCGTGGAGGGTCGGCTTCCCG
ACGCCACGAAGG
GGGTACGTAATCGGGTGGTGTAAGGTGCATTTTGGAGGATGTGAGGGCGATGTTGTTGGGTGTGAGGAGGGATGACGAGTTTCCGGATGCGGGTTGTGTTGATGAGAG
GAGTTTAGATGTGGTTGTCGTGTGCGGCTTCCAGGTGAAGTAGGCATGTGAAGGGGTAGGGGGAGGATATTGGTGGAAGTGACGTGTTGGTGGGCGTGTGGGTGGGCAGGTTTGGATCAC
CTCCGATGCGTGTTCACGAAGCAGATGGGGTTGACGGATAAAGACATTGTGGTGCTGTCGGGTGCACACACTCTG
TGGTAGGACATGGTGGGAATCGGGAGTGCCGAGATGGTGGTGGTG
TTGTGGAATGGTGCAAGGTTTGGGGAAAGGGGCGGTGGGTGAATTGGGTGGTGTGAGGAGGGTGAGTGGGTGCAGTGACTGAGCGGTGGATGTTGGTGGTGTGCGGTGTTGCAGGGGAGG
TGCCACAAGGACCGGTCCGGATTTGAGGGAGCATGGACGCCGAACCCCCTTAGATTCGACAACTCGTACTTCCA
CAGTGAGTGATGTGTGAATTGATGCAGGCCGGTGGGTGGGTTATGA
AGGCGATGCGAGTGGGTGAGATGGAGTTATCGTTGAGGATGTGGGCTAATGATTGTGATGGACATGGTCGTGGGTAGGGTGCTGTTGGAGGGAGAGAAGGATGGACTGATCATGCTGCCA
TCCGACAAGGCTCTGCTGGATGAGCCGAAGACTCGTGAGTTGGTTGAGTTGTACGCGAAG
AGGTATGTGCCGTGTTTTGTTTGGTGGTGACGTGGTTGTGTCGGAAAAAATCAGAATAGC
ATAGGGCCCATCGCCTTAAGGTAGTCTGTGTTAAGTGTAGAACGGATTGAGAGGGTGGTGTCCGGGTGCCATTGGTGAAGGTTGGTGGCGGTGATGATGTATTGAGTGGTGCTTGTGGGG
TGTGACAGGACGAGGACAAGTTTTTCGAAGACTACGCCGAGTCTCACATGAAGTTGTCAGAGCTAGGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTGGATTTGCAGATAAGAACTGTGCACCCATCATCCTTCGTCTCGCATGGCACGGGTCGGGAACTTACGATCAGGAGTCGAAGACAGGAGGTCCTCTTGGAACCATCCGGTTCGGGCAG
GAGCTTGCGCACGGCGCCAACGCGGGGCTGGACATTGCAGTGAATCTGCTGCAGCCCATCAAGGAGCAGTTTCCGGAGTTGTCGTACGCTGACTTTTACACG
CTGGCTGGAGTCGTTGCC
GTGGAGGTGACAGGCGGGCCCACCATTCCTTTTCACCCTGGGCGCAAG
GATCATGAGACATGCCCCGTGGAGGGTCGGCTTCCCGACGCCACGAAGGGTTTGGATCACCTCCGATGCGTG
TTCACGAAGCAGATGGGGTTGACGGATAAAGACATTGTGGTGCTGTCGGGTGCACACACTCTG
GGGAGGTGCCACAAGGACCGGTCCGGATTTGAGGGAGCATGGACGCCGAACCCCCTT
AGATTCGACAACTCGTACTTCCA
GGTGCTGTTGGAGGGAGAGAAGGATGGACTGATCATGCTGCCATCCGACAAGGCTCTGCTGGATGAGCCGAAGACTCGTGAGTTGGTTGAGTTGTAC
GCGAAG
GACGAGGACAAGTTTTTCGAAGACTACGCCGAGTCTCACATGAAGTTGTCAGAGCTAGGGTGA

Retrieve as FASTA