Entry information : SmAPx03-2_72 (SmAPx03b_72)
Entry ID 7199
Creation 2010-02-10 (Christophe Dunand)
Last sequence changes 2010-02-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmAPx03-2_72 (SmAPx03b_72)
Name (synonym) SmAPx03-2_72 (SmAPx03b_72)
Class Ascorbate peroxidase    [Orthogroup: APx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation Chloroplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmAPx03-2_72
start..stop
S start..stop
SmAPx03-1_65 714 0 1..348 1..348
LeAPx07 477 1.24e-170 11..343 4..345
AtrAPx03 480 1.32e-170 3..345 1..350
GmAPx08 476 6.68e-170 49..346 51..348
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7199' 'complement(join(296262..296291,296341..296445,296504..296581,296651..296725,296786..296872,296942..297009,297099..297186,297247..297347,297403..297523,297593..297748,297807..297944))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 297807..297944 136 N° 2 297593..297748 154 N° 3 297403..297523 119 N° 4 297247..297347 99
N° 5 297099..297186 86 N° 6 296942..297009 66 N° 7 296786..296872 85 N° 8 296651..296725 73
N° 9 296504..296581 76 N° 10 296341..296445 103 N° 11 296262..296291 28  
complement(join(296262..296291,296341..296445,296504..296581,296651..296725,2967 86..296872,296942..297009,297099..297186,297247..297347,297403..297523,297593..2 97748,297807..297944))


exon

Literature and cross-references SmAPx03-2_72 (SmAPx03b_72)
DNA ref. Phytozome 12:   scaffold_72 (297944..296262)
mRNA ref. JGI transcript:   157825
Protein sequence: SmAPx03-2_72 (SmAPx03b_72)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (323)
PWM (Da):   %s   37695.3 (35219.0)  
PI (pH):   %s   8.92 (8.60) Peptide Signal:   %s   cut: 26 range:26-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMASARSIVFSGALLCKSLPAVTARLSIAAAPHRRLSSSGLSLR
A
ACSRRIRTFAMSGSGAAAVESSQRIASQLDQLVGAREAIKEVITKMHCNPILIRLGWHDAGTYDKNISEWPKCGGANGSLRFSIELEHGANAGLINALKLLNPVKEKFTAVSYADLFQLA
SATAI
MAGGPRIPMRYGRVDTVGPEQCPKEGNLPSAGPPNPSEHLRKVFHRMGLDDDIVALSGAHTLGRSRPERSGWGKKETKYTKDGPGAPGGQSWTVEWLKFDNSYFKDIKEKRDEDL
LVLPTDAVLFEDPGFK
EHAELYAKDQDAFFKDYAQAHAKLSELGAKFDPPQGIRIDESTS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGGCGTCGGCGAGGTCGATCGTTTTCTCCGGGGCGCTTCTCTGCAAATCTCTCCCTGCTGTCACTGCCAGGCTCAGCATTGCTGCGGCGCCTCATCGGCGGCTCTCATCATCG
GGTTTGTCGCTCCGTGCG
GTGAGTGTTTGCCTCCTCTCTTTCTCGATGTCGATGGATCGTGTTTGCAACCGATCAGGCGCCTGCTCGCGGAGGATCAGAACTTTTGCCATGTCTGGGAGT
GGAGCCGCCGCCGTGGAATCGTCCCAGAGGATCGCGTCTCAGCTCGATCAGCTAGTGGGAGCGAGGGAAGCGATCAAGGAAGTGATCACGAAAATGCATTGCAATCCTATACTA
GTAAGT
AACAAAAAACTGTTTTCTTTTTTTTTCAACGATCAAACCTTGTGAGCTCTTTCGAATCGACAGATATTAGATTGGGATGGCACGACGCTGGAACGTATGACAAGAACATCAGCGAGTGGC
CCAAGTGTGGTGGTGCCAATGGAAGCCTGCGCTTCTCTATCGAGTTGGAACATGGAGCGAATGCTG
GTAACTTTTAGCAACTTGCGAAAAGCTTGTAACGATCCCTTCGAACTTACGGCA
GGAGACTCATAAATGCTCTCAAGCTGCTTAATCCCGTGAAGGAGAAATTCACCGCAGTAAGCTATGCCGATCTTTTCCAGCTTGCAAGCGCCACCGCCATAGAGGTAAACTTATCAAGAA
AGAACAAAGAAGCTGGCCTAAACTTCTAAAGGTGATGGAATCAGATATGGCTGGAGGACCCCGGATTCCAATGCGATATGGAAGAGTTGATACCGTAGGCCCAGAGCAATGCCCGAAGGA
GGGTAACCTTCCAA
GTAAGAATGAGTTTTCCAAGCGCTAGCCAACTTGGACTTCGACAAATGGTGTCCGTTCCTCTGACGCCTGGAATTAATTTTTTTTCCAGGTGTGCCGGACCCCCAA
ATCCTTCCGAGCACCTTCGCAAAGTGTTTCACAGGATGGGACTGGATGACAAG
GTGCGCTTTCCGCTTTGAAGAATTTTCCTGGCTTGAGCAGACTTTTACTCATCGCCTTGATATACCA
AGGAGACATTGTTGCCCTGTCAGGTGCTCATACCTTGGGACGATCTAGACCAGAACGGAGTGGCTGGGGAAAAAAGGAAACGAAATACACGGTAACGAAAGTGGTTCTTTCAGCATCTTC
GATGACATTTTGATGCTTGAGAACATGATAGAAAAAGACGGACCTGGAGCTCCAGGAGGCCAGTCCTGGACTGTGGAATGGCTGAAATTTGACAATTCATATTTCAAGGTAGACTTTATT
TCAAGGCCGGCAAAAGAAAATTTGGATAGTAGTGAACGCTGGTCGTATCGTATGCAGGAGATATCAAGGAGAAAAGAGACGAAGATCTTCTCGTCTTGCCAACGGACGCAGTCCTTTTCG
AAGATCCAGGATTCAAG
GTAAAGAATAGACCAACTTAAGAAAATTAGAAAAACTTATCTCAATGTGTATCTCCAGGAGAGCATGCCGAGCTCTACGCCAAGGATCAGGATGCGTTCTTCA
AGGACTATGCTCAAGCGCATGCCAAGCTGAGTGAACTGGGAGCCAAATTCGATCCACCTCAA
GTTTGTAGCTCTTGTTCTCCTCCTTGTTGGCTGACTGATGTGGTTGCAGGGGGAATCC
GGATCGACGAGAGCACAAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGGCGTCGGCGAGGTCGATCGTTTTCTCCGGGGCGCTTCTCTGCAAATCTCTCCCTGCTGTCACTGCCAGGCTCAGCATTGCTGCGGCGCCTCATCGGCGGCTCTCATCATCG
GGTTTGTCGCTCCGTGCG
GCCTGCTCGCGGAGGATCAGAACTTTTGCCATGTCTGGGAGTGGAGCCGCCGCCGTGGAATCGTCCCAGAGGATCGCGTCTCAGCTCGATCAGCTAGTGGGA
GCGAGGGAAGCGATCAAGGAAGTGATCACGAAAATGCATTGCAATCCTATACTA
ATTAGATTGGGATGGCACGACGCTGGAACGTATGACAAGAACATCAGCGAGTGGCCCAAGTGTGGT
GGTGCCAATGGAAGCCTGCGCTTCTCTATCGAGTTGGAACATGGAGCGAATGCTG
GACTCATAAATGCTCTCAAGCTGCTTAATCCCGTGAAGGAGAAATTCACCGCAGTAAGCTATGCC
GATCTTTTCCAGCTTGCAAGCGCCACCGCCATAGAG
ATGGCTGGAGGACCCCGGATTCCAATGCGATATGGAAGAGTTGATACCGTAGGCCCAGAGCAATGCCCGAAGGAGGGTAACCTT
CCAA
GTGCCGGACCCCCAAATCCTTCCGAGCACCTTCGCAAAGTGTTTCACAGGATGGGACTGGATGACAAGGACATTGTTGCCCTGTCAGGTGCTCATACCTTGGGACGATCTAGACCA
GAACGGAGTGGCTGGGGAAAAAAGGAAACGAAATACACG
AAAGACGGACCTGGAGCTCCAGGAGGCCAGTCCTGGACTGTGGAATGGCTGAAATTTGACAATTCATATTTCAAGGATATC
AAGGAGAAAAGAGACGAAGATCTTCTCGTCTTGCCAACGGACGCAGTCCTTTTCGAAGATCCAGGATTCAAG
GAGCATGCCGAGCTCTACGCCAAGGATCAGGATGCGTTCTTCAAGGAC
TATGCTCAAGCGCATGCCAAGCTGAGTGAACTGGGAGCCAAATTCGATCCACCTCAA
GGAATCCGGATCGACGAGAGCACAAGTTAG

Retrieve as FASTA