Entry information : SmAPx05-2_59 (SmAPx05b_59)
Entry ID 7203
Creation 2010-02-10 (Christophe Dunand)
Last sequence changes 2010-02-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmAPx05-2_59 (SmAPx05b_59)
Name (synonym) SmAPx05-2_59 (SmAPx05b_59)
Class Ascorbate peroxidase    [Orthogroup: APx2018]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmAPx05-2_59
start..stop
S start..stop
SmAPx05-1_109 583 0 1..286 1..286
CescAPx01 387 4.49e-137 1..246 1..244
TsAPx03-1A 385 3.02e-136 1..250 1..248
NnAPx02 385 3.09e-136 6..246 4..244
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7203' 'join(154122..154240,154301..154425,154483..154532,154600..154665,154720..154768,154844..154926,154976..155055,155125..155227,155278..155463)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 154122..154240 117 N° 2 154301..154425 123 N° 3 154483..154532 48 N° 4 154600..154665 64
N° 5 154720..154768 47 N° 6 154844..154926 81 N° 7 154976..155055 78 N° 8 155125..155227 101
N° 9 155278..155463 184  
join(154122..154240,154301..154425,154483..154532,154600..154665,154720..154768, 154844..154926,154976..155055,155125..155227,155278..155463)


exon

Literature and cross-references SmAPx05-2_59 (SmAPx05b_59)
DNA ref. Phytozome 12:   scaffold_59 (154122..155463)
mRNA ref. JGI transcript:   119039 (154122..155463)
Protein sequence: SmAPx05-2_59 (SmAPx05b_59)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   286
PWM (Da):   %s   31611.89 Transmb domain:   %s   o263-285i
PI (pH):   %s   4.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAEVPLVDHEYVMEIEKARQELRGMIVEKQCAPIMLRLAWHDAGTYDRETKTGGPNGSIRLEGEYNHIANRGIKAAIDLEEIKEKCPKISYADLYLAGVTAVEVTGGPTISFVSGRKDS
SVIPPEGRLPDASQ
GANHLRDVFGRMGLNDKDIVALSGGHTGRAHKDRSGFDGPWTSNPLIFDNSYFIELIEGEKTGLLKLPTDTCLMEDKVFRQYVETYADKDTFFRDYAWSHKKLSEL
GFIDHPDETQENTYDSSFTSITILIGVVITAAAVGLVAMIWS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGAAGTTCCCCTTGTTGATCATGAATATGTCATGGAAATCGAGAAGGCCAGGCAAGAGCTCCGTGGAATGATTGTTGAGAAGCAATGTGCTCCGATCATGCTAAGGCTAGCG
CGTAAGTGAATATATGGAGGTTGGTTTATTTGTATGATCTTGAAACATTTTTTTCTTTAAGGTGGCACGATGCAGGAACCTATGATCGGGAAACAAAAACAGGAGGTCCAAATGGATCAA
TTCGACTAGAGGGTGAATATAATCATATTGCAAATAGGGGCATTAAGGCTGCTATTGATCTTTGTG
TGGTGAGTAGAGTTTACTTTTGGCTGAATTCTGCAGTAATCATGATTTATTTTT
TCTAGAGGAAATCAAAGAGAAGTGCCCCAAAATAAGCTATGCAGATCTTTACCAGAGGTTTGCATTTTGAAATAAAAAGACAAATAATGTATCTGGCTCACATATATGTTGTTTGGATAA
TTAGCTAGCAGGAGTTACAGCAGTGGAAGTCACTGGAGGACCAACAATCAGTTTTGTTTCAGGAAGGAAAAAGTATGGTAAAACATTAATCTTTGAACACCATGCATTTTCTTTTTTTTC
TTACAGGATTCTTCAGTAATACCCCCTGAAGGACGTTTACCAGATGCTTCTCAAGAGGTCATTGATAATTTCTATATACTTTTCTTACTGATATGATAATTTTCCTTTATGATCTCTAAA
TTTGCAATTTAGGTGCAAATCACTTGAGAGATGTTTTTGGTAGGATGGGCTTAAATGACAAAGATATAGTTGCATTATCTGGTGGTCATACACTGTGGTGAGACCTTTGGGATTTATAAA
GTTTTTTTTAAAGACATTTTTGGCAGGGAAGAGCTCACAAGGACAGATCAGGATTTGATGGACCATGGACATCAAATCCTCTGATCTTTGACAATTCTTATTTCATATGTATAAGTCTTT
CTTCCTGTTCAAGTCTTTTTTTTTACCATTTTTTTTTCTTCTATTCCATGTGAACAGTGAGCTGATTGAAGGAGAAAAAACTGGACTTTTAAAGCTACCAACAGATACGTGTTTGATGGA
AGACAAAGTATTTCGTCAATATGTTGAAACTTATGCCAAG
AGGTAATCGATCACAAGGTTTGTGGAGATGATTATAATAATTTCGAGAGCAGGATAAAGACACATTTTTCCGTGATTACG
CGTGGTCTCATAAGAAATTATCTGAGCTCGGTTTCATCGATCACCCAGATGAAACCCAAGAGAACACATATGATAGCTCATTCACATCAATCACCATATTAATTGGAGTGGTGATCACAG
CAGCAGCAGTGGGTTTAGTTGCAATGATATGGTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGAAGTTCCCCTTGTTGATCATGAATATGTCATGGAAATCGAGAAGGCCAGGCAAGAGCTCCGTGGAATGATTGTTGAGAAGCAATGTGCTCCGATCATGCTAAGGCTAGCG
TGGCACGATGCAGGAACCTATGATCGGGAAACAAAAACAGGAGGTCCAAATGGATCAATTCGACTAGAGGGTGAATATAATCATATTGCAAATAGGGGCATTAAGGCTGCTATTGATCTT
TGTG
AGGAAATCAAAGAGAAGTGCCCCAAAATAAGCTATGCAGATCTTTACCAGCTAGCAGGAGTTACAGCAGTGGAAGTCACTGGAGGACCAACAATCAGTTTTGTTTCAGGAAGGAAA
GATTCTTCAGTAATACCCCCTGAAGGACGTTTACCAGATGCTTCTCAAGGTGCAAATCACTTGAGAGATGTTTTTGGTAGGATGGGCTTAAATGACAAAGATATAGTTGCATTATCTGGT
GGTCATACACTG
GGAAGAGCTCACAAGGACAGATCAGGATTTGATGGACCATGGACATCAAATCCTCTGATCTTTGACAATTCTTATTTCATTGAGCTGATTGAAGGAGAAAAAACTGGA
CTTTTAAAGCTACCAACAGATACGTGTTTGATGGAAGACAAAGTATTTCGTCAATATGTTGAAACTTATGCCAAG
GATAAAGACACATTTTTCCGTGATTACGCGTGGTCTCATAAGAAA
TTATCTGAGCTCGGTTTCATCGATCACCCAGATGAAACCCAAGAGAACACATATGATAGCTCATTCACATCAATCACCATATTAATTGGAGTGGTGATCACAGCAGCAGCAGTGGGTTTA
GTTGCAATGATATGGTCATGA

Retrieve as FASTA