Entry information : ZmPrx25
Entry ID 721
Creation 2007-11-19 (Christophe Dunand)
Last sequence changes 2007-11-19 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-01-31 (Qiang Li)
Peroxidase information: ZmPrx25
Name ZmPrx25
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Meristems
Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx25
start..stop
S start..stop
SbPrx20 655 0 1..336 1..337
SiPrx145 617 0 4..336 6..340
ZmPrx138 587 0 7..336 1..326
OsPrx39 515 0 33..336 28..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 31244141..31244377 237 N° 2 31243812..31244003 192 N° 3 31243092..31243254 163 N° 4 31242568..31242986 419
complement(join(31242568..31242986,31243092..31243254,31243812..31244003,3124414 1..31244377))


exon

Literature and cross-references ZmPrx25
Literature Walbot,V., unpublished.
Protein ref. UniProtKB:   B4FUT1   B4FBY8 [Incorrect splicing]
DNA ref. GenBank:   AC190506.1 (138784..136978)
Cluster/Prediction ref. UniGene:   Zm.21181
Protein sequence: ZmPrx25
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (314)
PWM (Da):   %s   35978.12 (33817.0)  
PI (pH):   %s   8.48 (8.39) Peptide Signal:   %s   cut: 33 range:23-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRGSMTCSLQLAVLVSAAIALGFGVRAGEAQLSSEYYGQTCPVVHRVARRVLKKAHEADVRIYASLTRLHFHDCFVQGCDGSILLDNSSSIVSEKFATPNNNSARGYPVVDAVKAALEEACPGVVSCADILAIAAKISVELSGGPRWRVPLGRRDGTTANITAANNLPSPFDNLTTLQQKFGAVGLDDTDLVALSGAHTFGRVQCQFVTARLYNFSGTNRPDPTLDRGYRAFLSLRCPRAGNASALNDLDPTTPDTFDNNYYTNIEARRGTLQSDQELLSTPGAPTAPIVGRFAASQKEFFRSFARSMVNMGNIQVLTGSQGEIRKNCRMVNGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns) and 55 ESTs. Contig also contains 2 others peroxidases.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCCGTGGCAGCATGACCTGTAGTCTTCAGCTCGCCGTCCTCGTTTCCGCCGCCATCGCGCTCGGGTTCGGCGTCCGGGCCGGCGAGGCGCAGCTGTCCAGCGAGTACTACGGC
CAGACGTGCCCCGTCGTGCACCGGGTCGCGCGGCGGGTGCTGAAGAAGGCGCACGAGGCCGACGTCCGCATCTACGCCAGCCTCACCCGCCTCCATTTCCACGACTGCTTCGTGCAA
GTA
AGAAGCAGCCGGCCCCGTGCCCGTGTTCCGCAGACGGCTGGCCACGACGCCGCGCGCGCGCGCGCGCTTGCCCTTCCCACACGCCGGCCGTGCGTGCGTTCTGAGCCTGCGTCCGCGTGT
GTTTGTTTCTTCAGGGCTGCGACGGCTCCATCCTGCTGGACAACAGCTCGAGCATCGTGTCGGAGAAGTTCGCCACGCCCAACAACAACTCGGCGCGCGGGTACCCCGTGGTCGACGCCG
TCAAGGCGGCGCTGGAGGAGGCTTGCCCAGGCGTTGTCTCCTGCGCTGACATACTGGCCATCGCCGCCAAGATCTCGGTCGAACTG
GTGAGTTTTTCTACCTATCGATCCACCGTTGGTC
ATCCCCAGTCTACTGTCTCCATCCGCAGAAGAACATAATTCTACCTCAGTACAGTAGGCTCGATGTCACCGTTAATGAGTTGATCTCGACGGAACGCCATTGTACAACAGCAAGCAAACA
AACTGTCGGACTGGCATTGTACCTTCTACCTTGCCTTGACCGGGAGGCAGTAGCTGTAGCTCTAGCCTCTAGGCCTGGAGACCTGGAGCAATAGTCCGAACAAAACTCCCGTCGGTGCAA
AATAATTGAACTAGTAGCTAGTATGGCCATTAGAGAGATCTACGAGAAGATGACAAAACTGCACGCCTTTTTTTTAAGATTAAAATTAAAAGCATGCAGAAACAGATAGATATCCTAGTA
CAGTATGACGTGCATATTCACACACGTCAACGTCACGTCACGTCGGCTGCCATCAGCAGGACGTTCGAGGGTCATAGGCGCCCGTCAGTGTCCTCTCCGTGCCACGCTTTAATCCAACAC
GGCCACATGACGCGTGGTCCCTCCCTTTTCACCATGCGCGCAGTCCGGCGGGCCAAGGTGGCGCGTGCCTCTCGGCCGGCGCGACGGCACCACGGCCAACATCACCGCCGCCAACAACCT
CCCGAGCCCCTTCGACAACCTCACTACGCTCCAGCAGAAGTTCGGCGCCGTCGGCCTCGACGACACCGACCTCGTCGCGCTCTCAG
GTAAAAAAAAAAGGGGGGGAGAGAAAACCGGCGA
TGCATGCCTCGTGATTCTTGCACCTGCACAGCACGACACATGGCGTCACAACGACGGCGGATGCATTGCAGGGGCGCACACGTTCGGGCGCGTGCAGTGCCAGTTCGTGACGGCGCGGCT
GTACAACTTCAGCGGGACGAACCGGCCGGACCCGACGCTGGACAGGGGGTACCGGGCGTTCCTCTCCCTGCGGTGCCCGAGGGCCGGCAACGCGTCGGCGCTCAACGACCTCGACCCGAC
CACGCCGGACACCTTCGACAACAATTACTACACCAACATCGAGGCGCGCCGTGGGACGCTGCAGTCCGACCAGGAGCTGCTGTCGACGCCCGGCGCGCCCACGGCGCCGATCGTCGGACG
GTTCGCCGCCAGCCAGAAGGAGTTCTTCAGGAGCTTCGCCAGGTCCATGGTCAACATGGGGAACATCCAGGTGCTGACGGGGAGTCAGGGTGAGATCAGGAAGAACTGTAGGATGGTCAA
CGGAAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCCGTGGCAGCATGACCTGTAGTCTTCAGCTCGCCGTCCTCGTTTCCGCCGCCATCGCGCTCGGGTTCGGCGTCCGGGCCGGCGAGGCGCAGCTGTCCAGCGAGTACTACGGC
CAGACGTGCCCCGTCGTGCACCGGGTCGCGCGGCGGGTGCTGAAGAAGGCGCACGAGGCCGACGTCCGCATCTACGCCAGCCTCACCCGCCTCCATTTCCACGACTGCTTCGTGCAA
GGC
TGCGACGGCTCCATCCTGCTGGACAACAGCTCGAGCATCGTGTCGGAGAAGTTCGCCACGCCCAACAACAACTCGGCGCGCGGGTACCCCGTGGTCGACGCCGTCAAGGCGGCGCTGGAG
GAGGCTTGCCCAGGCGTTGTCTCCTGCGCTGACATACTGGCCATCGCCGCCAAGATCTCGGTCGAACTG
TCCGGCGGGCCAAGGTGGCGCGTGCCTCTCGGCCGGCGCGACGGCACCACG
GCCAACATCACCGCCGCCAACAACCTCCCGAGCCCCTTCGACAACCTCACTACGCTCCAGCAGAAGTTCGGCGCCGTCGGCCTCGACGACACCGACCTCGTCGCGCTCTCAG
GGGCGCAC
ACGTTCGGGCGCGTGCAGTGCCAGTTCGTGACGGCGCGGCTGTACAACTTCAGCGGGACGAACCGGCCGGACCCGACGCTGGACAGGGGGTACCGGGCGTTCCTCTCCCTGCGGTGCCCG
AGGGCCGGCAACGCGTCGGCGCTCAACGACCTCGACCCGACCACGCCGGACACCTTCGACAACAATTACTACACCAACATCGAGGCGCGCCGTGGGACGCTGCAGTCCGACCAGGAGCTG
CTGTCGACGCCCGGCGCGCCCACGGCGCCGATCGTCGGACGGTTCGCCGCCAGCCAGAAGGAGTTCTTCAGGAGCTTCGCCAGGTCCATGGTCAACATGGGGAACATCCAGGTGCTGACG
GGGAGTCAGGGTGAGATCAGGAAGAACTGTAGGATGGTCAACGGAAGCTAG

Retrieve as FASTA