Entry information : ZmPrx28(Zm00001d027411 / GRMZM2G341934 / Peroxidase 66)
Entry ID 724
Creation 2005-06-13 (Christophe Dunand)
Last sequence changes 2005-06-13 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-09 (Christophe Dunand)
Peroxidase information: ZmPrx28(Zm00001d027411 / GRMZM2G341934 / Peroxidase 66)
Name ZmPrx28(Zm00001d027411 / GRMZM2G341934 / Peroxidase 66)
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Apical meristems
Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx28
start..stop
S start..stop
SbPrx23_BTx623 555 0 10..329 15..333
SofPrx03 554 0 23..329 27..330
SiPrx154 518 0 4..329 9..331
OsPrx33 496 1.76e-178 4..329 7..331
Gene structure Fichier Exons


exon

Literature and cross-references ZmPrx28(Zm00001d027411 / GRMZM2G341934 / Peroxidase 66)
Literature Chen,H.D., Zhang,X., Zhou,R.L., Arias L,A.C., Shendelman,J.M., Zazubovits,N., Borsuk,L.A., Emrich,S.J., Ashlock,D.A., Scanlon,M.J. and Schnable,P.S. Expressed Sequence Tags from B73 Maize Shoot Apical Meristems. Unpublished (2004).
Protein ref. UniProtKB:   B4FNL8  B4FAL5 [Incorrect splicing]  B4FLI3 [Incorrect splicing]  B6TFD7 [Incorrect splicing]
DNA ref. GenBank:   AC191256.3 (39133..36235)
Cluster/Prediction ref. UniGene:   Zm.19224
Protein sequence: ZmPrx28(Zm00001d027411 / GRMZM2G341934 / Peroxidase 66)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   33357.64 (30950.3)  
PI (pH):   %s   4.85 (4.60) Peptide Signal:   %s   cut: 26 range:26-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVGRGAATALVWAAVVAVATVVSRAQQLQVGFYDTLCPAAEIIVQ
EEVSKAASGNPGVAAGLLRLHFHDCFVR
GCDASVLLDSSAGNQAEKDAAPNASLRGFEVIDSAKTRLEQACFGVVSCADVLAFAARDALALVGGDAYQVPAGRRDGNVSSAQEAGANLPPPTASASQLTQAFGAKGLSQAEMVALSGA
HTVGAARCSSFAPRLYSYGPSGAGQDPSMDPAYLAALAQQCPPQGTGAADPPLPMDPVTPTAFDTNYYANLVARRGLLASDQALLADPATAAQVLAYTNSPATFQTDFVAAMIKMGAIQV
LTGTAGTVRTNCRVAS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, introns 1 and 2) and 275 ESTs. Also found in AC155424.2. Cultivar="B73"
DNA
Send to BLAST
CDS
Send to BLAST